Identifiers and Description

Gene Model Identifier

Contig3315.g3547

Standard Name

ACT11 (ACT11 - Actin-like 1a)

Aliases

None

Description

ACT11 - Actin-like 1a

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3315.g3547(protein)
MSDQQTCVIDNGSGVVKAGFSGEDAPRAIFPSIVGRPKNSSALIGVDSATEYLGDEAQQK
RGVLKIFYPIEHGIVKDWDDMEKIWNHTFYVELRVSPDEHPVLLTEAPLNPKINREKMTQ
IMFETFNVPALYVAIQAVLSLYSAGRTTGIVCDAGDGVTHTVPIYEGFSIPHAVQRIQLA
GRDLTMFMAKLLTERGYVFTSSAEMEIVRDIKEKLCFVALDYESALKQSHDSTEFDKIYE
LPNGEVINIGNERFRCPEYLFKPLEMNGSEFTSIQDLTSDSIQLCDVDIRRNLYQNIILS
GGTTMYEGIGERLLKEIEDRAPKSITVKVIADPDRRLAVWRGGSLLTSLSTFDSMWITKQ
DYDENGAIIVHSKCF


>Contig3315.g3547(coding)
atgagtgatcaacaaacttgtgttattgataatggatctggagtcgtcaaggccggtttc
tcaggagaagacgccccaagagctatcttcccatcaatcgttggtagacccaagaactcc
agtgctttgatcggagttgattcagccactgaataccttggtgatgaagcccaacaaaag
agaggagtcttaaagattttctaccccatcgagcacggtattgtcaaggattgggatgat
atggaaaagatctggaaccataccttttacgttgagcttagagtctccccagacgagcac
ccagtactcttgactgaggcaccactcaacccaaagattaacagagagaagatgactcaa
atcatgttcgagacattcaatgtacccgctctttatgttgccattcaagccgttctctct
ctctactccgctggtagaaccaccggtattgtttgcgatgctggagatggtgttacccac
accgtccccatctatgagggtttctctattccccatgccgtccaaagaattcaacttgcc
ggtagagatctcaccatgttcatggctaagctccttactgagagaggttatgtcttcact
tcttctgctgagatggaaatcgttagagacatcaaagaaaagttatgctttgtcgctttg
gattatgagtctgctcttaagcaatctcacgatagcaccgaattcgataaaatctacgaa
ctcccaaatggcgaagtcattaatattggtaacgagagattcagatgccccgaatacttg
ttcaagccacttgaaatgaacggaagtgagtttacttcaatccaagatttgacttccgat
tcaatctaattgtgtgatgttgatatcagaagaaatctctatcaaaacattatcctatct
ggaggtaccactatgtacgaaggtattggtgaaagactcctcaaggaaatagaagacaga
gcacctaaatcaattactgtcaaagttattgctgatccagacagaagactcgccgtatgg
agaggaggttctctccttacttcactctcaacattcgattcaatgtggattaccaaataa
gactacgacgagaatggagcaataattgttcatagtaaatgtttctga