Identifiers and Description

Gene Model Identifier

Contig16367.g17431

Standard Name

CAFB1 (Chromatin assembly factor 1 subunit b-like, putative histone chaperone)

Aliases

None

Description

Chromatin assembly factor 1 subunit b-like, putative histone chaperone

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16367.g17431(protein)
MSIDVYPNSNYFITTSVVSDEDTGIRFWEIIPESHYQDHAKFSPGGISTTTTGSKYRIEY
RYDLQGGHTSTINVVRFSPNGQYLASGSDDQMVIIWSLKSVPVQFGSKEEVIQWGHPRQL
RGHVGDVMDLCWSRQNGPNDQSCYLVSCSVDGTAILWNIGGNKFSKIQTFDGHKKLVQGV
SLDPMMKYIITMSSDSTIRGYKNRKLKTQLQFFHKFTLKNREEETEGTDENVPMNIDSGN
NQNESENNVNAPAVSGNQEAKNKKCSHRMFLDDVEYLSFVRRLTWSPDGTFFLTPASVFQ
DLQSESKNLYTVYGFLKSDITQPAFMLPGIKSYATCIKFNPYLYKKSTEPMNPERPALLD
LPYKVIFAVGSGEQVIVYSSESVYPMAVLGNLHYASINDLSWIVTSDTNVKLLVASSDGF
CSFISFEIQDNGLTLLGQRLISSEVPEKLKGIYEAQERVDFKRLELEAIENNSKKNQFKN
VTFKSKINPTSAGTTNNNNSTFKGPGDVEMIRT


>Contig16367.g17431(coding)
atgtcgattgatgtctaccccaattcaaactatttcatcaccacctcagtagtatccgat
gaggacactggcatcagattttgggagatcataccagaaagccactactaagatcatgct
aaattttcacccggtggaatatccactactacgacaggaagcaagtatagaatcgaatat
agatatgaccttcaaggcgggcacacttcaactataaatgtagtcagatttagtccaaat
gggtaataccttgcttccggctctgatgactaaatggtcattatatggagcctcaaaagt
gttccagtatagtttggaagcaaagaggaagtgatttaatggggccatcctagacaactt
agagggcacgtaggcgatgtcatggatttatgctggtcaagatagaatggaccgaatgat
tagagctgctatttggtgtcctgctcagttgatggcactgcaattctatggaatatcgga
ggaaataaattcagcaaaatttagacatttgatggacataagaaattggtctaaggagtt
tcattggacccaatgatgaagtatattattacaatgagtagcgatagcacaataagaggc
tataaaaataggaaactaaagactcagcttcagtttttccataaatttactcttaagaac
agagaagaagagacagagggaacagatgagaatgtgccaatgaacattgactcaggtaat
aactaaaacgaatcagaaaataatgtaaatgcacctgcagttagcggaaattaagaagcg
aagaataaaaagtgctcacacagaatgttcctggatgatgtcgaatacctgagctttgta
agaagactcacttggagtccagacggcactttcttccttacaccagcctcagttttctaa
gatttacaatctgaaagtaaaaatttgtacacggtttatggatttcttaaatctgacatt
actcagccagctttcatgcttccaggaatcaagtcatatgctacttgcattaaattcaat
ccatatctctataagaagtcaactgagcctatgaacccagagagaccagcccttttagat
ctgccttataaagtgatctttgcagtaggttctggagaacaagtcattgtgtattcaagt
gaaagtgtctatccaatggcagtgcttggaaacttgcattatgcatctattaatgatcta
agttggatcgtcactagcgatactaatgttaagctcttagtagcctctagtgatggtttc
tgctcctttatctcctttgaaatccaagataatggtttaactctactaggacaaagatta
atttctagtgaagtacctgagaagctaaaaggtatttatgaggcataggagagagtagac
tttaagagattggagctagaagcaattgaaaacaatagtaaaaagaatcaatttaagaat
gtcaccttcaaatctaaaattaatcctacaagtgcaggcacaacaaataacaataatagc
acttttaaaggacctggagatgtcgaaatgataagaacttga