Identifiers and Description

Gene Model Identifier

Contig2323.g2503

Standard Name

CDL2 (Chromodomain-like 2)

Aliases

None

Description

Chromodomain-like 2, m-phase phosphoprotein 8

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

  • nuclear-transcribed mRNA catabolic process, 5'-3' exonucleolytic nonsense-mediated decay (IEA) | GO:0070479
  • protein demannosylation (IEA) | GO:0036507

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2323.g2503(protein)
MVRKSARSVNQTITNQYVVNEEYLRELIEQDNDFEPYPELLPSEKAQLESDNENDASMFT
VEKILDKRKEGRRIFYLVKWEGYAEDQATWEPLSNLQNVKELLKEFDRQFELGVMNNNST
NVSVNPNNSTNNDNDRNMEFTQDNDEMQYMVQRNSHDKLIPISSKSKSIKKGWSKKFEKQ
HSQYDAISVNQTLEKHSCVKTEPLSQKIKAKKQGSKSQEIIEDTEEQIKILNKQKEIIKQ
QQYQIEEQLQILEQIKQHNKIRQLSLQCGIKSNTNNVDTQVSPEKSRSQAKLTKTKNLTY
KRGKQSVLKQISQQQQTDGLGQSDLMAKANPKKPGRKKKNAIVNDTTNEAQTNQDQSEQF
DPTCCEINTEEINELVQDELPQEGVLEFDTPVSIKSAKMINGQINIVIEWQVRKNGFKPL
ESMITNDQAKQKCPNLLVDFYESKISSIKSQNVTTADQQKDNQKYSKQIQNPEQEQISKS


>Contig2323.g2503(coding)
atggttaggaagagtgcaagatctgtaaatcaaaccataactaatcaatatgtggtaaac
gaggaatatcttagagagctaattgagcaagataatgattttgaaccgtatccagaatta
ttgccttcagaaaaagcctagcttgagtctgacaatgaaaatgatgcatccatgtttacg
gttgaaaagatattagataaaagaaaagaaggcagacgtatattttacctagttaaatgg
gaaggatatgctgaggactaggcaacatgggaacctcttagtaacctttaaaatgtgaaa
gaactcctgaaggaatttgatagacaatttgaacttggagtaatgaataataattctact
aacgtctctgtaaatccaaacaattcaaccaataatgataatgatagaaacatggaattc
acttaggataacgatgaaatgcagtatatggtttagaggaactcccatgataagcttatt
ccaattagctctaaaagtaaatctataaagaaaggatggtctaaaaaatttgaaaaataa
cactcttaatatgatgcaatatcggtaaattaaactttggagaaacattcatgtgttaaa
actgagccgcttagctaaaaaattaaagctaaaaaataaggctctaaaagctaagagata
atagaggacactgaggagtaaataaaaattttgaacaagtaaaaggagattattaaacaa
taataatattaaattgaggaataattgcaaatattagaataaattaaatagcataataaa
ataagatagttatcgctctaatgtggaataaaatcaaatactaataacgtagatactcaa
gtgagtcctgaaaaatctcgatcttaagcaaaattaacgaagactaagaacttaacatat
aaaagaggcaagtaatcagtattaaagcaaataagctaataatagtagacagatggatta
gggtaatcagatttaatggcgaaagctaatcctaagaaacctggcagaaagaaaaaaaat
gcaatagtaaatgatactacaaatgaggcttagactaattaggactagagtgaatagttt
gatccaacttgctgtgaaataaatactgaagaaatcaatgaattagtttaggatgaatta
cctcaagaaggtgtattagaatttgataccccagtttcaattaaatctgccaagatgata
aatggtcaaattaatatagtaatagaatggcaagtaaggaaaaatggtttcaagcctctt
gaaagtatgattaccaatgattaagctaaataaaaatgccctaatctgctagtagatttt
tacgaaagtaaaattagctcaattaaatcgcaaaatgtaacaacagctgattaataaaaa
gataactaaaaatatagcaagtaaatatagaaccctgaataagaataaattagtaaaagt
tga