Identifiers and Description

Gene Model Identifier

Contig10759.g11510

Standard Name

HIS34 (Macronuclear gene encoding histone variant H3.4)

Aliases

H3v4

Description

histone variant H3.4

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • mitotic nuclear envelope reassembly (IEA) | GO:0007084
  • response to continuous far red light stimulus by the high-irradiance response system (IEA) | GO:0010201

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
5HIS34Histone gene HIS34 encoding histone variant H3.4, formerly H3v4 (before 2013). Renamed with respect to: Talbert PB et al. A unified phylogeny-based nomenclature for histone variants. Epigenetics Chromatin. 2012 Jun 21;5:7. doi: 10.1186/1756-8935-5-7. PubMed PMID: 22650316; PubMed Central PMCID: PMC3380720.

Associated Literature

  1. Ref:24502432: Forcob S, Bulic A, Jönsson F, Lipps HJ, Postberg J (2014) Differential expression of histone H3 genes and selective association of the variant H3.7 with a specific sequence class in Stylonychia macronuclear development. Epigenetics & chromatin 7(1):4

Sequences

>Contig10759.g11510(protein)
MARTKQTARKQTGAKAPRKALANKAARKTAPADGGVKKPHRFRPGTVALREIRKYQKSTE
LLIRKLPFQRLVREIASDYKSDLRFQSSAVAAIQEAAEAYMVGLFEDTNLCAIHAGRVTI
MPKDIQLARRIRGERS


>Contig10759.g11510(coding)
atggcaaggacaaaataaaccgctagaaaataaactggtgcaaaggctccaagaaaggcc
cttgcaaataaagctgcaagaaagactgctcctgctgatggtggagttaagaaacctcac
agattcagaccaggcactgtggcactcagagaaatcagaaaatatcagaagtcaactgaa
ttgcttatcagaaagttgccattctagagacttgtgagagaaattgcttcagattacaaa
agtgacttgagattctaatcctcagctgtagctgccatttaggaagcagccgaagcatac
atggtcgggctatttgaagatactaacttgtgtgccattcatgctggaagagtcacaatc
atgcctaaggacattcaacttgctagaagaatcagaggggagagatcatga