Identifiers and Description

Gene Model Identifier

Contig2639.g2830

Standard Name

HIS32 (Macronuclear gene encoding histone variant H3.2 )

Aliases

H3.2 | H3v2 | H3v7 | H3v9

Description

histone variant H3.2

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
2HIS32Histone gene HIS32 encoding histone variant H3.2, formerly H3v2/v7/v9 (before 2013). Renamed with respect to: Talbert PB et al. A unified phylogeny-based nomenclature for histone variants. Epigenetics Chromatin. 2012 Jun 21;5:7. doi: 10.1186/1756-8935-5-7. PubMed PMID: 22650316; PubMed Central PMCID: PMC3380720.
4HIS32Possibly 3 paralogs encoding 2 protein variants exist: H3.2a, H3.2b(S29L).

Associated Literature

  1. Ref:24502432: Forcob S, Bulic A, Jönsson F, Lipps HJ, Postberg J (2014) Differential expression of histone H3 genes and selective association of the variant H3.7 with a specific sequence class in Stylonychia macronuclear development. Epigenetics & chromatin 7(1):4

Sequences

>Contig2639.g2830(protein)
MARTKQTARKNTGGKAPRKHIAHKQAKKSSAAAATGGVKKPHRFRPGTVALREIRRFQKS
TELLIRKLPFQRLVREIASEFKNDLRFQSSAVLALQEASEAYLVGLFEDTNLAAIHAKRV
TIMPKDMQLARRIRGERS


>Contig2639.g2830(coding)
atggcaagaaccaagcaaaccgcaagaaagaacactggaggcaaagccccaagaaagcac
attgcacacaaacaagctaagaaatcatcagcagccgctgctactggtggtgtcaagaag
ccacacagattcagaccaggtaccgttgctctcagagaaatcagaagattccaaaagagc
accgagctcctcatcagaaagctccccttccaaagactcgtaagagaaatcgcttctgag
ttcaagaacgacctaagattccaatcatcagctgtccttgctctccaagaagcctcagag
gcttacctcgtaggtcttttcgaagacaccaacctcgccgccatccacgccaagagagtc
accatcatgccaaaggacatgcaactcgctagaagaatcagaggtgagagatcttga