Identifiers and Description

Gene Model Identifier

Contig19568.g20748

Standard Name

DCL2 (Dicer-like 2; RNase III)

Aliases

None

Description

Dicer-like 2; RNase III

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IEA) | GO:0005749

Molecular Function

Biological Process

  • complement activation, classical pathway (IEA) | GO:0006958
  • regulation of mitotic cell cycle spindle assembly checkpoint (IEA) | GO:0090266
  • nucleoside triphosphate catabolic process (IEA) | GO:0009143
  • nucleoside triphosphate biosynthetic process (IEA) | GO:0009142

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19568.g20748(protein)
MLQQNNTQAENFQQDSQDETKSNISSTFTLFDLKKSMSILRDLYGVPICEQPLVTEDERI
EKYLALRDLKEFLESSQDQDSMRVLQNRQILSQLSKQVTLDELKPLEYDSDEEFIKIDTS
IQLSQHIGEPMMDIFQQQLDENGHLLIEIEGINHNMSDEAQVKLYIEQLKDLFKRERGKD
SIKKNNLGDIFSTQIETSIILQSHLLPQNEYERIDKHQTIIYGNVKALIPMFREKLQVEH
LPTEDETTFKTRYKRGNQASIMDKRIFGILTRYQVGYVPGVDICFTEDDQTFVRDSYVFK
SLISKNLYEQQNLNDDQIETVRVSIEQEKFRLNCYNDYSYEAIKDDNQQHYVRVATLNQI
ETFHRYLMNDLYKEEKAINFSKAFTQGRELDKKYYFVPLRLVPNPNSNTLEYTIDRKLLS
KVEKLSQEGYRSCQIPIIDEIKVKGIQTLQERLDYLNKYILVKEDKPHRCYHFHTILEDL
NQLSAEELVKAIKGSTDNLVCKTAYELLFNAATRFQSINSFRQSLVEGHIGDRQKIETSP
IMLLDPAKVISHFKFKYSLDQCPKNIISSKNQYKKRFKAKNNLTTSQGKPIFSSFNIFKH
YMNIIHWKRASQLPLIMQFFERSLYCHQLTAELGTYIHPEFVLWATSAPDNKASKKSYET
LETYGDTILKLAATLLSYFHLQNEQDADESKIDQLKIVFITNLYLLRVGKRLKLSKYIRN
NEQDLNKWSPPFSEQVQQTENLSCTGKNVADCVESIIGAHFMTNNVRRTFELISNMKIVP
LVQAHLIDMFPDKDLTFVLSQELDDYKFDIENDKVEDIYRKYVEVHMIDQNIQNYLHSII
RKDKPVDRFGSAYFDYLSSQNIKDKLCSEIEQDLIQLLSPVEDIINYKFQNKKLLLEALT
HKTFKDNYGLTLFYEKLEVLGDAILDYLANSNLIKYTILEKYNLKERLSQQYITSEDFQP
FDAHQAKSLLTKNDFLAKLVCLFGIHKYILYFKPKQMMPAELKENLILENNGEFEPWKYA
KKLKELGNQVDFDKYIRYSFKQDFLINGKETEIYEAPKILGDIFESLVGAIFIDGGIEKV
LDVYQHLLSPFILFVAKFSKKLNKEPKEDFMIQANLLRIKPVFKHQELNVTDISQYIAFD
NFKDSDDSLFNNGLAQSEEESMTMTHKLFKVDIIFNNNEVMTSGIGNTRKQAERNASIMG
QKWLLDNTKQSQNIENILNEFMQDI


>Contig19568.g20748(coding)
atgttgcagtagaacaatacttaagcagaaaatttccagtaagactcctaagatgaaact
aaatctaatatttcctcaacattcacgttgtttgatctgaagaaatcaatgtcaattttg
agagacctctatggagtaccgatttgcgaataaccattggtcactgaagatgagagaatc
gagaaatatttggccttgcgtgatctaaaagaatttctagagtcttctcaggattaagat
tcaatgagagtgctttagaacagataaatacttagttaattatcgaaataagtgacatta
gacgagctaaaaccattagaatatgattctgacgaagaattcataaaaattgacacatcg
atctaattgtcttaacacattggagagccaatgatggacatcttttagtagcaattggat
gaaaatgggcatttattaatagaaatcgaaggcattaatcataatatgtctgatgaagcg
caagtcaaactttacatcgagcaacttaaggatctatttaaaagagaaagaggcaaagac
tcaataaaaaagaataatttgggagatatattcagcacatagattgaaacatcaatcata
ctataatcacacttactaccataaaatgagtatgagcgtattgataaacatcaaaccatt
atttatggaaacgttaaggctttaatccctatgtttagagagaaactgcaggttgaacac
ctacctactgaagatgaaactacatttaagaccagatataaacgaggcaactaagctagc
atcatggataagaggatattcggtatacttacaagatatcaagtcggatatgttccagga
gtagatatttgctttactgaggatgatcaaacattcgttagagattcttacgttttcaaa
agtttgatttctaagaatctctatgagcaacaaaatttaaatgatgatcagattgagaca
gtaagagtaagcattgaacaagaaaaattcagactcaattgctataatgattattcttat
gaagcaatcaaggatgataatcagtagcactatgttagagtagctacactcaatcagata
gaaacattccatcgatatcttatgaatgatctctataaagaagagaaagcaattaatttt
agtaaagcatttactcaaggaagagaacttgataaaaaatattactttgttcctttaaga
cttgttccaaaccctaatagtaatactctggaatatacgattgataggaaattattatca
aaggttgaaaaactaagttaagaaggctatagatcatgctaaataccaatcattgatgaa
ataaaggtaaaaggaatctaaacattgtaggaaaggcttgattacttaaataaatatatt
cttgtgaaagaagataagcctcacagatgctatcatttccatacaatacttgaagacctc
aattaactctctgctgaagaattagttaaagccattaaggggtctactgataatctagtg
tgtaaaactgcttatgaactcttgtttaatgccgccactagattctagtctattaattca
ttcagataaagtttagttgagggtcatatcggagatagacaaaagattgagacctctcct
ataatgctattagatcctgcaaaagttatttctcattttaagttcaaatactcattggac
taatgccctaaaaatattatcagctctaagaatcaatataaaaagagattcaaagcgaag
aataacttaactacttcttaaggaaaacctattttctcctcgttcaacatttttaagcat
tatatgaatatcattcactggaaaagagccagtcaactccctttaataatgcaattcttc
gaaagatccctctactgccatcaactaacagcagagttaggaacatacatacatccagag
ttcgtactatgggcaacttctgcacctgataacaaagcttctaaaaagtcttatgaaaca
ctagaaacctatggagacaccatactcaaacttgcagcgacacttttatcttactttcat
ctttaaaatgagcaagatgcggatgaatcaaagattgattaactcaagatagtattcatc
actaatctttatctgcttagagttggaaaaagactaaagttaagcaagtatataagaaat
aatgaataggatttgaataaatggagtccacctttttctgaataagtttagtaaacagaa
aatctatcttgcactggtaaaaatgtggcagactgtgtagaaagcataatcggagcacat
ttcatgactaataatgtgagaagaacatttgaactaatttctaatatgaagatagtgccc
cttgtataagcacatttgattgacatgtttccagataaagatctaacatttgtccttagt
taggaacttgatgattataagtttgatatcgagaatgacaaagttgaggacatttataga
aagtatgtagaagttcatatgattgaccaaaacatctaaaattatcttcacagcattatt
agaaaagataagccagttgatagattcggttctgcttactttgactacttatcatctcaa
aatataaaggataaattatgctctgagattgaacaagatctaattcaactactttcccca
gttgaagatataataaactataagttctaaaataagaaattattgttagaagccttaact
cataagactttcaaagataattatggcttgacattattttatgaaaaacttgaagtcctt
ggagatgccattttagactatttagcaaactctaacttgataaagtatactattcttgag
aaatataacctgaaagagagactctcctaacagtatattacctcagaggacttccagcca
tttgatgctcattaagccaaatccttgctgactaagaatgattttcttgccaaattggta
tgcctattcggtatacataagtatattctttactttaagccaaagtaaatgatgccagca
gaattgaaagagaatttgatattggaaaataatggggaatttgaaccttggaagtatgca
aagaagcttaaagagcttggaaatcaagttgactttgataagtatatcagatattcattt
aaataagatttcttaattaatggcaaagaaactgaaatatatgaagcgcctaagattctg
ggtgatatatttgaatctctcgttggagcgatattcattgatggaggaatagagaaagtt
ctagatgtttatcaacacctgctctcacctttcattttatttgtggccaaatttagcaag
aaactaaacaaagaacctaaggaggactttatgattcaagctaatttgcttagaataaag
ccagtatttaaacatcaagaactaaatgtcactgatatttcttagtatatagcatttgat
aatttcaaggatagtgatgactctctttttaataatggtttggcttagagtgaagaagag
tctatgactatgactcataaactatttaaagttgatataatattcaataataatgaagtg
atgacctctggcatagggaatactagaaaataagctgagagaaatgcaagtattatggga
taaaagtggcttttggataatactaagcaaagctaaaatattgagaacattttgaatgag
tttatgtaggatatttga