Identifiers and Description

Gene Model Identifier

Contig14771.g15738

Standard Name

DCL3 (Dicer-like 3)

Aliases

None

Description

Dicer-like 3

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IEA) | GO:0005749
  • collagen type XII trimer (IEA) | GO:0005595

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14771.g15738(protein)
MNYLKDFDRNAEINESFVNDLMEYQQKKTIQFSQYKPEPRHNPSSRALKYNLGEMIKERL
NIQNIITNHNSRQINRSQNNQISRIDIRHRQSLISESRDKIESFNNSNLFSDVQIDDTIQ
REKKIQAYQNYLYPQNPESNNCNTDTEMNQENNEMLEESKISNANHQIAQQQYQQKQYQS
QYTSFTNQNGRNDNDVEMRDIPHYSLNESLIESQSDLQSLYEMKSFPYQDKICQKCLYYW
DKEPYGSIIFLETGSGKSYIAIKMIQHIFGFPLELNLLSEEKMLQKRQKQIIKKAFDPQH
FQNHDIFICISKKFYDLMLHGVLSFKDIDLLIFDEAHHCEQDHFQLQEFGIKTRILGLTA
SPVKSKIMVDDIYKFTLKTNLQTLSNNLYSRFIPIEQHDLNQMKNQAYVYVETYDSKISE
NIDFVSRIEQELIKPLLDLVQIKLEIYKMIDLNEKKSSQSEQLMKLCNRNLLQQSIDAQD
IQMEKFISGRLKLIELDIDLSKKQIDLGFFNNDQDRTIVILAITLLKNINNLIIELGQHG
VNFFIHDLNKEIIQQQGKIDSKKQKIEQIFQQYIHNLQLHLTDPIELSVDRSLNENYYLS
GKVNELIRILEKEYESRKQQEQNQNLKAIIFVKDRIVAEYLKRILESRYNQQNNQSDLSR
VLDDKSLNLDDGFSIDDEELQQQQLNYQSNSKFKFGLAIGYQGKSMMNKAYKSTKVPKND
DIEDYICSLPKFSPVQLSNQKLNETIMKFRKDVINVLIATSVIEEGLDVSSCNLVICLNE
ILSVKSFIQTKGRARQSNSKFIFLCAHEEKDKYNTEISGFNQTIRIIQEIAYDQEESVVP
DSKIIEKKIMNQPPSLRTPLQAKCSMRDAPSLVKQLVQELNQGLSDKQFDLSMIFHLRDQ
NQAYINCVNQHQELRFDMSRLKINIIVITDEKRNKNQQQFSSTLIMPHSLKCLISHIKDT
QLFSKKNEAENHVYLLALFYFYELGFLDQNLYSNLESIRKYPSIIKKLNNIQPEPKIKVQ
VIQDPNAPKQPSKKEQNLHDRELLNEESKLFQQQTKERGNKFSFQVKKDLINKTFNQRVE
YHTEQVNESAMDVDYENQSTIEKHFKKKLYAIVIHGLDDEYNNNNYPFLDTKQHLGIIQD
EDLEDIRYQYNLQQDVKQKQKNKFYLENLWNFKNFDEAILFQKIQMSDELKFTKSSFEIK
DFGPYSSLWEFSNKLNLFHTWIFFMIYNNQHQFFQRLIMGKFSFSYLFQTVFQLIIKDKR
ITLRENRGFLQYVYELNKEQVWGNEQFDPKKIHDQKKINIQTYIIPIKDQNGVKEINFKL
IDQLESYIKVEMIKFFFSDYQVHKTIQNLGLEHDIYSKFLLYKEENQFKNIHNNSILDED
IEMKMEDSLENQISHSQIVMRQPKFNNLEYIQVCESNHNLYQIMSLKKQTDKLWHKKQIH
LLPNKYKREYPNVHENTLKAMYGENLTLQEHYFAKTGIYLDKKENQIFFKCSKMRHFLDY
SQQKTPEDGEKTNSKYPEQHSSINTEFDVPLQLLGLTPFTYEQYQVLQSTCFHLSQINEM
QIVRQFIIKFYSKVKIINGDPLINLQLEHPVLNIHQIALQPPDSNTFRTAADFFLYDPSC
IIEALSSPTANRPIDYERLEFYGDSVISFLVILELFLCGSKSWSEGDLDFNRIKKVSNRN
FININERIGLYQYMISEQAKIYNDYVPVGFETQDYMQNIKLKHLNELTTKIIHLKKQAFF
IELEKKKNFQQCINDFVTEEYIELTKLFITQRDLNLYLVEKHPKAIQIIEEEKMLSYQTS
ECLLTRIGQRWINELSLKIPQLKEIVVNENIKKCYRKLDDEMKKRYKSDQIPNREKKLYQ
PKQLADVVESITGALTFKTNLFTTQSFLKSEIKLLEHEVEEYDRELDQLRLGEVQLTDEL
SSQIAQLEGLLGYSFQSKHLVLQALTHKSTKEHSSQVQGSYHDYERLEFFGDSILNFLVA
QYYFLTTQFDPDHNKPKQLHKYKTSVVNNVLLSLIVIEKGIYNSIIYNQQSKQFKDQFDK
YVQEVQIRINNAQTMDIARYFYLNNIYGQRDKIEISHRLGYFITRDPIDYDQGRNHQINN
QQYLNNAINVDQRELQKLGVIDLDELHESSLKIFGDIFESIIGAIFIDSKSLEITSQILF
NLLKPYMVVYGNIDPALDHKRTVLLELWNSKVYSKNLKLWHKLQILFSF


>Contig14771.g15738(coding)
atgaactatttaaaagatttcgatagaaatgcggagataaatgagtcattcgtcaatgat
cttatggaatattagtagaaaaaaacgatatagttttcataatacaagcctgaaccaaga
cataacccatctagcagggctttgaagtataatttgggtgagatgatcaaagaacgatta
aatatacaaaatataattactaatcacaatagcaggcaaatcaatagatctcaaaacaat
taaatcagcagaatagatataagacacaggtaatcattgatttcagaatcaagggacaag
attgaatcatttaacaattcaaacctcttttcagatgtgcaaattgatgatacaatacaa
agagagaagaaaattcaagcttatcagaactacctatacccttaaaacccagaaagtaat
aactgcaatactgacactgagatgaactaagaaaacaatgaaatgcttgaagaatctaaa
atttctaatgccaatcattaaatagcgcaatagcaatactagcaaaaatagtatcagagc
taatatacttcattcaccaattaaaatggcagaaatgacaatgatgtcgagatgagagat
attcctcactattctctgaatgaatctctaattgaaagctaatctgatttgtagtcactc
tacgagatgaagagtttcccttaccaagacaaaatttgttaaaagtgtctatactactgg
gataaagaaccttatgggtccattatttttcttgaaactggttctggcaagagttatatt
gcaattaagatgattcaacatatttttgggtttccattagaattaaatctgctaagtgag
gagaaaatgctttaaaagagataaaaacaaatcataaagaaagcatttgatccctaacat
tttcaaaatcatgatatcttcatctgcattagtaaaaagttctatgatctcatgctgcac
ggagtcctcagtttcaaggatattgatctcctaatttttgacgaagcacatcattgtgaa
taggatcatttttagctttaagaatttggaataaaaacaagaatcttaggacttacagca
tctccagtcaaatccaaaataatggttgatgatatctacaagttcactcttaaaacgaat
ctctagacactgtcaaataatctctactctagatttatcccaattgagtagcatgatctt
aattaaatgaagaatcaggcttatgtgtatgtggaaacatatgactctaagatatctgaa
aatattgattttgtaagtaggatagagcaagaactgataaaaccactcttagaccttgtt
taaattaaattggaaatttacaaaatgattgatcttaatgagaaaaagagtagccagtct
gaataacttatgaaactctgcaatcgaaatctattgtagcagtccatcgatgcctaggat
atttagatggaaaaattcatcagtggcagacttaaactgatagaacttgatattgactta
tcgaagaaacagatagatttgggcttcttcaacaatgactaggatagaactatagtaatt
cttgccattactcttctaaaaaatattaacaacttgattattgagcttggtcagcatgga
gtaaacttctttattcacgatttaaacaaagaaatcatttaataacaaggaaaaatcgat
tctaagaaatagaagattgaatagattttctagtagtacattcataatcttcaattgcat
cttaccgatccaatagagctgtctgtcgatagatccttaaatgaaaactactatttgtct
ggtaaggttaatgaattgataaggattctggaaaaagagtatgagagtagaaagcagtag
gaataaaactaaaatctaaaggcaatcattttcgtgaaggatagaatagtagctgaatat
ttaaagaggatactagagtctagatataactagtagaacaattagagtgaccttagtaga
gtactagatgataaatcgttaaatttagatgatgggttcagcattgatgatgaagaatta
cagtagcaataattaaactatcaatccaattccaaattcaaatttggactggctattgga
tactagggtaaaagtatgatgaacaaagcttacaaatcgaccaaggtgccaaagaatgat
gacatcgaagattacatttgttcattacctaagttttcccctgtacagttatcgaatcaa
aagctcaatgaaactattatgaagttcagaaaggatgttattaatgtactaattgccacc
agtgtgattgaggaagggttagatgtttctagttgtaacttggttatttgcttaaatgag
attctaagcgtgaaatcattcatttaaactaaaggtagagcaagacaatccaattcaaaa
tttatatttctttgcgctcatgaggaaaaggacaaatacaacactgaaatatcaggattc
aattaaaccattaggattatttaagagatagcttatgatcaagaggaaagtgttgtccct
gattcgaagatcatagaaaagaaaataatgaatcaaccaccttctttaagaactcctctt
taggcaaaatgctcaatgagagatgcacctagtctagtcaagtagttagtgcaagagcta
aaccaaggtctctctgataaataatttgacttgtccatgatattccatctcagagatcaa
aattaggcttacattaattgcgtgaatcagcactaagagttaagatttgacatgagccga
ttgaaaattaatatcattgtcattacagacgaaaagagaaataaaaattagcaataattc
tcaagcactctaataatgcctcatagccttaaatgtctgattagtcacatcaaagataca
tagctattcagcaagaagaatgaggctgaaaaccatgtatatctgctagccttgttctat
ttctatgaactgggattcttagatcagaacttgtactctaatttggaaagtatcagaaaa
tatccatcaataataaaaaaattgaataatatttaacctgaaccgaaaattaaagtgcag
gttatataggatccaaatgctcctaaatagccatcgaagaaggaatagaatctccatgat
agagaacttctcaatgaagaatctaagttatttcaatagcaaaccaaggaaagagggaat
aaatttagcttttaagtaaagaaagacctcattaataagactttcaatcagagagtagag
tatcatactgagcaagtgaatgaatccgctatggacgtggattatgagaattagtctact
attgaaaaacattttaaaaagaagctatacgctattgtcattcacggacttgatgatgaa
tataataacaacaattatccatttcttgacacaaaatagcatcttggcattatttaagat
gaagatttggaggatattagataccaatacaatcttcagtaagacgtcaagcaaaagcaa
aagaataagttttatcttgaaaatctttggaatttcaaaaattttgacgaagccatttta
tttcaaaagatttaaatgtcagatgagcttaagtttaccaaatcttccttcgaaatcaaa
gactttggcccctacagctcactctgggaattttcaaataagcttaatctatttcacaca
tggatcttttttatgatttacaacaactagcaccaattcttttagagactcataatggga
aaatttagctttagctatctattttagacagtatttcaacttataatcaaagacaaaaga
attactctcagagaaaatagagggttcttgcagtatgtttacgagttgaataaggaataa
gtctggggtaatgagtaatttgatcccaaaaaaattcacgactaaaaaaaaattaatatt
tagacttacattattcctatcaaggattagaatggtgtgaaagagataaatttcaaactt
atcgattagcttgaatcttatataaaagtagagatgataaagttctttttttctgattac
caagtacacaagactatctaaaacttaggtcttgagcatgatatttactcaaagttcttg
ctctataaagaagaaaactagtttaagaatattcacaataattctattttagatgaggat
attgaaatgaaaatggaggatagtttagaaaattaaatctctcattcataaattgtaatg
agataacctaagttcaacaacctcgagtatatttaagtttgcgagagcaaccataatcta
tattagatcatgagtctgaagaaataaactgataaactttggcataaaaagcaaattcat
cttctcccaaataagtataaaagagagtatcccaacgttcatgagaatactttgaaggca
atgtatggagaaaacttaactctataggagcattattttgcaaagacaggtatatattta
gataaaaaggagaattagattttcttcaagtgcagtaagatgagacattttctggattac
tcttagtaaaagactccagaggatggggaaaagactaatagtaaatatccagaataacac
tcctctatcaacactgaattcgatgtaccactgcaacttctaggcctaactcctttcacc
tatgaacaatactaagtacttcagtctacttgctttcatctatcataaataaatgagatg
caaatagtaagacagtttattatcaaattctactcaaaggtgaaaatcatcaatggagat
ccacttataaatctttaactagaacatcctgttttaaatatccattaaattgccttgcaa
ccaccggattctaatacattcagaacagctgctgactttttcttgtatgatccaagctgt
ataattgaagcattaagttctccaactgcaaatagacctatagattatgaaagactggaa
ttttatggtgatagtgtgataagcttcctagttattttagagctttttctttgtgggtct
aaatcttggagtgaaggagatcttgattttaatagaatcaagaaagtatctaatagaaat
ttcattaacatcaatgagagaataggtctatattagtacatgatctctgagcaggctaaa
atatataatgactacgttccagttggatttgaaactcaagactatatgcaaaatatcaag
ttaaaacacctcaatgaacttaccactaaaattattcatttgaagaagcaggcatttttc
attgagctagaaaagaagaagaacttctaatagtgtattaatgacttcgttactgaagaa
tatattgaactgacaaaactctttataacgtaaagagaccttaacctttatctagttgaa
aaacacccaaaagctatataaatcattgaagaggaaaaaatgctgagctattaaacaagt
gaatgcttattaactagaatcggttaaagatggataaacgaattgtctctgaaaattcct
caacttaaggaaatcgttgttaatgagaatatcaagaagtgctacaggaaattggatgat
gaaatgaaaaagagatacaaaagtgactaaattcccaatcgcgagaaaaagctatattaa
cctaaatagctggcagatgtggtagaatcgatcactggtgctctaactttcaaaactaat
ttattcacaacctagagtttcctgaagagcgagataaagttattagaacatgaagttgaa
gaatatgacagagaactagatcagcttagattaggtgaagtttagcttacagatgaactg
tcctcataaattgcacaattagaggggctacttggttacagtttctaatctaagcatctt
gtcttataagcacttactcataaatcgacaaaggagcattcaagtcaagtttaaggatcc
tatcatgactatgagagattagaattctttggagattctattttgaactttttagtagct
caatactatttcttaactactcaattcgatcctgatcataataaacctaaatagcttcat
aagtataaaacatcggttgttaataatgtgctattgagtttgattgttatcgaaaaaggg
atatataatagtatcatctacaaccagtagtcaaagcaattcaaagattaatttgataag
tacgtacaggaagtacaaattagaatcaataacgcataaacaatggatattgctagatat
ttctatttgaataatatttatggttaaagagacaagattgagatttcacaccgtttaggt
tacttcataaccagagacccaatagattatgattaagggagaaatcactaaattaataat
caataatatcttaataatgctatcaatgtagattagagagagttgcaaaaattaggagtg
attgatttagatgagttgcatgagtctagtttaaagatttttggtgatatttttgaaagc
ataattggagctatattcattgattcaaagagtctagaaataacttcccagatccttttc
aacttactcaaaccctatatggtcgtgtatggaaatattgatccagctcttgatcataaa
agaactgtgcttttggaactttggaattcaaaagtctattctaaaaacttaaagctttgg
cataaactgtaaattttattttcattttga