Identifiers and Description

Gene Model Identifier

Contig13617.g14524

Standard Name

DEAD1 (DEAD/DEAH box helicase)

Aliases

None

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • transcription initiation from RNA polymerase III hybrid type promoter (IEA) | GO:0001036
  • obsolete centromere binding (IEA) | GO:0007002
  • transcription from RNA polymerase III type 3 promoter (IEA) | GO:0001035
  • iodide transmembrane transport (IEA) | GO:1904200
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13617.g14524(protein)
MDKLTKEQLFKQSNYYKMSQKRDYEKVNPQKGGLLNKKYQSDNREPVDRQNINLIESTNE
IDYELLNALQNLNDDDIADCVMMGGIDDYIPNQSFMRKNSDSITAKQPTINANNVGGGNS
QENDDSDSDKPINLSEIGDYPMIDNADNGDIDPNCELELLAQQMEEELWKSDNDSLNGDQ
NDGENQHGSYQKHLDIHEKEELNKFKTEWNQPFSWDQEINIANQTIFGNEDFRENQREII
NATKSGKDVLALIPTGGGKSLTFQLSAVTDKGVTFVVMPLLSLIEDNFNFVTEVGIPSCN
LSSTSSGQKEENRISQCYREIKNVQYKLVYLTPEKLVKSPGLMNTMDHLYSVGLIDRFVI
DEVHCVSHWGQDFRKDYLHLDMLKQRYPTVPLLCLTATATLKVKDDIAKRLRIQQKVICF
QSSFNRTNLFYEIRDKKAIKDITVDLVNMLKTRFRGKSGIIYCISKNDCQVLSEKLRRNH
DINCDFYHADVPYKQRKLIQERWMKNQIQIIIATIAFGMGINKKDVRFVIHYSMPKSLEG
YVQECGRAGRDGQKAECILYYAYGDRKRNDFFIVTNNDNTNTRKNENVHALYSMLQYCEE
PYECRRKLQLEFLGEQFDKSKCLQMCDNCRQDLNLVERNYAREAQTIVRLVQECQKYNTF
VSYKQAIEVLRGKKLQKQFLRADQLEFYSGKLKPVSEKDLRRLIIHLLRMKLLKESFQKQ
KFGKSIQQIIVYLIPGRQNLINDLQRDILEINLSFGEKKDPKKDQLDIQMGGVNDKQSKP
AIQAENQALVPRQIVREEVKEQTEDGKRNYVKHRADIVSFVDQQHARKKTPITLANNSED
IDQYSSLVNNGFSNSNINNMTANVVINNDIVKQNAVEERDYGYQKPKYSNHQEIGIIQNH
NSSSSNRISSNNGQGLNHNNNLDISLQSLDTTRSMKLQRTGESLRIPQLILTEIQKEELR
QRLYLIRNRLLSLTEDDEQLAVSTAFSNTGFKTFLSFAQENLNDNAPEIINLLKEGKSAS
VRGAIDKYGHLFIMEFNHFLRLHKSHLLINKDFNPATVRQINYQEDNDHENLDYFELKKK
KSNGPASKLKQSNGNAEENWIPKKKAFPNYKPDEVMDGNYGFGNTTMDAFDEISKPAITV
NHMQQKQNTNSYDQFDNSDEESDNDAGSESGDQSNLEIKTTGGYGKFKGQGSKKRKFNGI
SGFGQSNIAPNKKKRKLNNKKAKKFH


>Contig13617.g14524(coding)
atggataaattgacaaaagagcagcttttcaagcagagcaactattataagatgagctag
aagagagactatgagaaagtaaacccttagaaaggaggtcttctgaataagaaatatcaa
agtgataatagggaaccagtcgatagacagaatataaatctgatagaaagcactaatgaa
attgactatgaacttttaaatgcactttaaaacttaaatgatgatgatatagctgactgc
gtaatgatgggtggaatcgacgattatattcctaatcaatcattcatgagaaaaaacagc
gactcaattactgctaaatagccaacaataaatgcaaataatgttggtggaggaaatagc
taagaaaatgacgattctgatagtgataaacccataaacttatctgagataggagactat
ccaatgatagacaacgcagataatggggacattgatcccaactgtgaactcgaattatta
gcctaataaatggaagaagagctatggaaaagcgataatgatagtctcaatggagatcag
aatgatggggaaaattagcatggatcttatcagaaacatcttgacatccatgagaaggaa
gagcttaataagttcaagaccgaatggaaccagcccttttcttgggactaggaaatcaac
atagctaattagacaatttttggaaacgaggactttagagaaaattagcgggaaatcatt
aatgctactaagagtggcaaagacgtgcttgcactaattccaactggtggtggtaaatct
ctaaccttttagctctctgctgtgactgacaagggtgtgacatttgtggtcatgccactt
ctcagtctgatcgaagataacttcaattttgtcactgaggttggcattccttcttgcaac
ttatcttctaccagttctggccagaaagaggagaacagaattagttagtgctatagagaa
atcaagaatgtccagtataaacttgtctacctgactccagagaagttggtaaaaagtcca
ggacttatgaacactatggatcatctctattcagtaggtcttatagatagatttgtaata
gacgaagtgcattgtgtcagtcattggggtcaagacttcagaaaagactacttgcacttg
gacatgcttaagcagagatatcctactgtcccacttctatgtttaactgccacagctacc
ttgaaagttaaggatgatatcgcgaagcgattgcgaattcagtaaaaagtaatatgcttc
taaagttccttcaacagaactaacctattttatgaaattagagacaagaaagccatcaag
gatataactgttgacttggtgaatatgctcaagactagattcagggggaaaagtggaatt
atttactgcatatccaagaacgattgctaggttttatctgaaaagttacgaagaaatcat
gatattaactgcgatttttatcatgctgatgtgccttataagcaaagaaaattgatacaa
gagagatggatgaagaactagatatagattatcatagctactattgcttttggaatggga
atcaacaaaaaggatgtgagatttgtaatacattactcaatgcctaagagtttggagggg
tacgtttaagaatgtggcagagctggaagagatggataaaaagcagaatgcattctttat
tatgcttatggagatagaaaaaggaatgatttcttcatagtaactaataatgataacact
aatacaagaaagaatgaaaatgttcacgctctttactcaatgcttcagtattgcgaggaa
ccctatgaatgcagaagaaaacttcagcttgaattcctaggagaacaattcgataaaagt
aaatgcctccaaatgtgcgataattgcagataagacttaaacttagtcgagagaaattat
gccagagaagctcaaacaatagtcaggctagtttaagagtgctagaaatacaataccttt
gtttcttataagtaagctatagaggtgctaagaggtaagaaactacaaaagcagttcctt
agagcagattaactagagttctattcaggtaaactaaagccagtgagtgaaaaagatctt
aggaggttgattattcatttgcttagaatgaagctgctcaaagagtcattctagaaatag
aaatttggtaagagcatacagcagattatagtgtacttgatccctgggagatagaacttg
ataaatgatttgcaaagagacattcttgagatcaacttgagtttcggggagaaaaaagat
cccaagaaggatcagcttgatatctaaatgggtggtgtcaatgataagcaatccaagcca
gctatttaagcagaaaattaagcacttgtgcctcgctagatagtaagagaagaagtcaaa
gaataaacagaagatggcaaaagaaattatgtgaaacacagagcagatattgtctcattt
gtagattagcagcatgctcgtaagaaaactcccataactctagcaaataactcagaagat
atagattaatacagttcattagtcaacaatggattcagcaatagtaatatcaacaatatg
actgctaatgtagtcatcaacaatgatattgtcaaatagaatgctgtagaggaacgggat
tatggctattaaaagccaaaatatagtaaccactaggaaattgggataatctagaatcat
aattcatctagttctaatagaatatcaagcaacaatggctaaggcttgaatcataacaat
aatctggatatttctctgcaatcgcttgacaccactagatcaatgaagctctaaagaact
ggggaaagtctaaggatcccataacttattcttactgagattcaaaaagaggagctgagg
caaagactatatttgataaggaacagacttcttagtctcactgaagatgatgagtaattg
gctgtgtccactgctttttccaatactggatttaaaacttttctttcctttgctcaggaa
aacctaaatgataatgcacctgagattataaatctacttaaggaaggtaaatctgcttca
gtaagaggagcaattgataagtacggacacttatttataatggagttcaatcatttctta
aggctacataaatctcacctgttgataaataaagacttcaatccagctacagtgaggtaa
ataaattattaagaggataatgatcatgaaaacttggattattttgaactcaaaaaaaag
aaaagtaatggccccgcatctaagttaaagtaaagtaatggaaacgctgaagaaaactgg
attcctaagaaaaaggctttccctaattataagccagatgaagtgatggacggcaactat
ggatttggtaacacaacaatggacgcttttgatgagatatctaaacctgcgattactgtt
aatcacatgtagtagaaatagaatacaaattcctacgattaattcgataactcagatgaa
gaaagtgacaatgatgctgggtctgaaagcggggatcaatctaatttagaaattaaaacg
actggtggatatggtaaattcaaggggcaaggaagtaaaaaaagaaaattcaatggtatc
tctggctttggttaaagtaacattgcgcctaataagaaaaaaagaaaactcaataacaaa
aaagcaaagaaatttcattga