Identifiers and Description

Gene Model Identifier

Contig10826.g11574

Standard Name

DEAD12 (DEAD/DEAH-box RNA helicase)

Aliases

None

Description

DEAD/DEAH-box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10826.g11574(protein)
MYSSVLAQSVQTNTYQGRGSFSNADQESLEETQEYQKTSAVSFARNSNILSNMNKYGIPI
LPKGNQALAEDDDPFDAYMRQIENQATLENEQTLKHQQELEEKALKKLLKKDGKGVLTGN
PLDKDEIENEVAEDIDAKNDSFKHKKIEQFHSKNFKYDDSDEEDVKPILKILCLQAYMKN
PRGGDMDDLDEELINKQEKILDENGQIDYEKLRLMEKKGIQALQALDHSQIEYDQFEKNF
YKEHPDITNMSFDQINSIRRELLIRVEGERVPRPFTAFNHLLVDQWIKDQINKVGYEKPT
PIQSQALPCTLQGRDVIGIAKTGSGKTLSYLIPMLVHILDQRPLEKNEGPIGLVMAPTRE
LCQQIYNEYKKYAKRYNVNVLPIFGGVNQHQIWKDIKAGRNEIIIATPGRLIDMIRKKAF
NLASRCTFLVIDEADQMFNMGFEYQIRSVVGQIRPDRQTLLFSATFKQQTQNLCSDILID
PIKIIIGKVGVSNEDISQTVLIFKKDMDKLQWLIESLGNFLIRGNQVLIFANQIQTVEQL
EKDLAVVYRTKGLACLHGDKTQFERTHIFDRVKKGEINILISTNVASRGLDIPNIKTVIN
YDCAKDKDDHVHRIGRTGRADDKEGVAYTLITKNESSKATMLIKILEQSNQIVSEELEEL
ALSDPNFRKSRVTIGIKNFNMKINVAKESKEMKKNARKIGDRTGIGFSTNEGNNDETETK
KMNAQQKRSADLAFKEEMINQKIAREAQLLFSQNNGGNILDHMDEYSERFKDTMKMQFNQ
TFVSSGKVQTTTKEATVTFVTKGDNATREIVRLEELETPQISTEIYQIKKAQGSRNLYRD
YRGDRRRSQSKDKKRKRSRSSSYSSSSSSRSRSRDRRKRRSSSRDRNSLSTKSHRNSDPY
HRNQTKTDRHYSDRDKKESYRSQRHESNKNNYSSSSKSEKHRIRGDYHDSKSRSRSRDKY
RENNFDRQGEAKQQENTRKRISKWDIKPQDS


>Contig10826.g11574(coding)
atgtactcttcagttttagcttaatctgtttagaccaacacctactagggaagaggaagt
ttttcaaatgctgactaagagtcgcttgaggaaacataagagtactaaaaaactagtgca
gttagttttgctagaaactcaaacattttgtctaatatgaataagtatggaataccgatt
ctaccgaaaggaaattaagcattagcagaggatgatgatccttttgatgcgtatatgaga
tagattgaaaattaagcaactttagagaatgaataaactcttaaacactagtaagaactt
gaagagaaagctcttaaaaaactcttaaagaaagatggcaagggtgtactaacaggaaat
cccttagacaaagatgaaatagagaatgaggttgcagaagacattgatgcgaaaaatgat
agttttaagcacaaaaagattgagtaatttcatagtaagaacttcaaatatgatgactct
gatgaagaagatgtaaaacctattttaaaaatattatgcttataggcctatatgaaaaac
cctagaggtggtgatatggatgatttagatgaggaactaattaataaacaggaaaaaata
ttggatgaaaatgggcaaatcgattatgagaaactaaggctgatggagaaaaaaggaatt
taagcattgcaagcactggatcattcctagattgaatatgattagtttgagaagaatttt
tataaagagcatccagatattacaaatatgagttttgattagatcaactccataaggaga
gagttattaatcagggtagagggagaaagagttccaagaccattcactgctttcaatcat
ttgcttgttgattaatggatcaaagattaaatcaataaggttggctatgagaagccaaca
cctatttaaagctaggctctgccttgtactctacaaggtagggatgttataggtattgca
aaaacaggctcaggaaagactctatcttaccttattccaatgctagttcatatcttggat
taaagacctttagaaaaaaatgaaggacctattggtttggttatggctcccacaagagaa
ctctgtcaataaatatacaatgaatataaaaaatatgcaaagagatataatgtgaatgtg
cttcctattttcggtggagttaactaacatcaaatctggaaagatattaaagcaggaaga
aatgaaattataatagcaacacctggaagattaatagatatgatcaggaaaaaggcattc
aatttggcaagtagatgcacatttttggttatcgatgaagcagaccaaatgtttaatatg
ggttttgaatatcaaattaggtcggtagttggacaaataagaccagacagataaacacta
cttttttctgcaactttcaagtagtagacataaaatctctgcagtgacatattgattgat
ccaattaagattataatcggtaaagtcggagtctctaatgaagatataagtcagacagtg
cttatattcaaaaaggatatggataaattatagtggctaattgaatctcttggtaatttt
ctcattagagggaatcaagtgctaatatttgcaaatcaaatttaaactgtagagtaacta
gagaaagatctagctgtggtgtacagaactaagggtctagcatgcttacatggagataag
acataatttgaaagaactcatatttttgacagagtcaagaaaggagagattaatatactt
atatctactaatgttgccagcagagggttggatattccgaatataaaaactgtcattaac
tatgattgcgccaaggataaagatgatcatgtgcatcgtataggcagaacaggtagagct
gatgataaggaaggagttgcctacactctcatcactaaaaatgagtcaagcaaagctact
atgctgataaagatccttgagcaatctaatcaaatagttagtgaagaacttgaggagtta
gcattgagtgatccgaatttcagaaagagcagagtgactattggcataaagaatttcaat
atgaagattaatgttgctaaggagtcaaaagagatgaagaagaatgctagaaagattgga
gatagaactggaatcggcttcagtactaatgaaggaaacaatgatgaaactgaaactaag
aaaatgaatgcatagcaaaaaagatcagcagatcttgcattcaaagaggagatgataaat
cagaagatagcgagggaggcttaattattattttctcagaataatggtggaaatattctt
gatcatatggatgaatactcagagagattcaaagacaccatgaagatgcaattcaatcag
acatttgtctcttctggcaaggtataaacaacaactaaggaggcaactgtaacatttgtt
actaagggagacaatgcaacaagagagattgtcaggctagaggaacttgaaactccttaa
attagtacagagatttactaaataaagaaagcttagggctcaagaaatctttatagagat
tatagaggagatagaagaagatcttaaagtaaagataaaaaaagaaagagaagtagaagt
agcagttatagtagcagttcaagcagcagaagtagaagtagagacagaagaaaaagaaga
tcttcaagtagagatcgaaatagtctttcaaccaaaagtcatagaaattctgacccttat
catagaaattaaaccaaaacagatagacattactctgatagagataaaaaagaaagctat
agaagtcaaagacatgaatcaaataagaataattactcttcctcatcaaaaagtgaaaag
cacagaataagaggtgattatcatgacagtaaatctagatcaagaagtagagataaatat
agagagaataactttgatagataaggtgaagctaaacagcaggaaaatactaggaaaaga
atcagtaaatgggatatcaaaccataggattcttga