Identifiers and Description

Gene Model Identifier

Contig13726.g14638

Standard Name

DEAD19 (DEAD/DEAH-box RNA helicase)

Aliases

None

Description

DEAD/DEAH-box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13726.g14638(protein)
MDSYPDFLRQSLLELNYKHPSNIQKIIYETFIKPKGDAMINRQNLIAQSLNGSGKTLAYL
SLMIRNMMASKVKPQQTEQQPQIQQINQEIQYQDCHVIQGLIITPTREIAMQVQEYLDFL
TKSTDETLKSRLTTFLVIGGLDIKEQRRKILVNKPNIIIGTPGRIKEMIIDREWLSLTAL
DTLIIDEADKFCVQNTNYYQSDKNKQGKKNNNMNQGKFFEDLASIINLIDEQQVQICAFS
ATFNSNTMTQLKNLIKKAIVIKAQSNDSPKNVKGLVDKEEQILKNIQKIYISLKSNDFNS
KLIQLGELLTQLMNQSSDQQIVLDSANQESEKQVSSQIIIFFNFKHQGEQLAKFIRSKLN
LTTVFFHGDQSQEDRLKAFEKMRLMEIKVILSTDLLSRGIDLPDVKTVINFDMPLNEAEF
RHRIGRSGRFGRAGMCVSIISETEQKKIQYISQMIQSQVMIQVNTLNLLASLKSQTTSED
QNEQLMAKQRQEKEVKLIKNQKHIEKNFSQKQQDYKKQKILSKEGKMSEWQDTTYTFYDE
NQFMYVEENEEDEEFKMDQDQEMIDESYEDQNHIKTLAQLLELDSQDLDANESKTSQSNR
DDKIQSTQQLQTDKKSFCISDLILFESDQFKEFKQKINDKIKQDSTFRQLVDELMFANYC
QYRDYYQALIKNQ


>Contig13726.g14638(coding)
atggattcgtaccctgattttcttagataatcattgcttgagttaaactataaacatcca
agcaacattcagaaaataatttatgagacttttataaaacctaaaggagatgcaatgatc
aatagataaaatctaatagcgtaatcattgaatggtagcggcaaaactttagcatatctc
tccttaatgattagaaatatgatggcgagtaaagtgaaaccataataaactgagtaatag
ccacagatctagcaaattaattaagaaatttagtatcaagattgccacgtaatataagga
ttgatcattactccaacccgagagatagcaatgcaagtctaagaataccttgactttctg
acgaaatcaactgatgaaacattaaaatctagattgactacctttttagttataggagga
cttgacattaaagaatagagaaggaagatattggttaataagcctaatatcattattggc
acacccggtagaataaaagagatgatcattgatagagaatggctaagcttaactgctcta
gacaccttgatcattgatgaggcagataaattttgtgttcaaaatactaattattattaa
agtgataaaaataagcaaggcaaaaaaaacaataacatgaattaagggaaattttttgaa
gatctagcttctattataaatctaattgatgagcaataagttcagatatgtgctttttca
gcaacatttaacagcaacactatgacttaacttaaaaatcttattaaaaaagcaatagta
ataaaggcatagtccaatgatagtcccaaaaatgtaaaaggtcttgtagataaagaagag
tagatcttgaagaatatctaaaaaatatatatttctctaaagagtaatgatttcaacagt
aaacttattcaacttggagaattattaacacagttaatgaactagagctcagactagtaa
attgttctagattcagctaattaggagtctgagaaataagtctcatcttagatcataata
ttctttaactttaagcatcaaggagagtagttagccaagtttataagatccaagctaaat
cttactactgtcttctttcacggtgattagagctaggaggatagactaaaagcatttgag
aagatgagattaatggaaattaaagtaatactgtcgactgatttgctgtcaagagggatc
gatttgccagatgtaaagactgttatcaattttgacatgcctttaaatgaagctgagttt
agacatagaataggaaggagcggtagatttggtagagcaggcatgtgcgtatcaataata
agtgaaactgaacaaaagaagatctagtatatatcataaatgattcagagttaggttatg
atataagtaaacacattgaacttattagcaagtctaaaatcataaacaacatctgaagat
taaaatgaatagttaatggcaaaatagagacaagaaaaggaggtcaagctgataaaaaat
caaaagcatattgagaagaattttagtcaaaagtaacaggattataaaaagcaaaagatc
cttagcaaggaggggaaaatgtcggagtggcaagatacaacctatactttctacgatgaa
aatcagtttatgtatgttgaggaaaacgaagaggatgaggaatttaaaatggattaagat
caggagatgattgatgaatcttatgaagactaaaatcatattaaaaccttagcataatta
cttgaactagattcctaggacctggatgctaatgaaagtaaaacaagttagagtaataga
gatgataaaatttaaagtacttaataactataaactgacaaaaaaagcttttgtataagt
gatttgatactttttgaaagtgattaattcaaggaattcaaataaaagatcaatgataag
ataaagtaagattccactttcagatagttagttgatgaattgatgtttgccaattactgc
cagtatagagattattatcaagccctaattaaaaattaatga