Identifiers and Description

Gene Model Identifier

Contig16814.g17910

Standard Name

DEAD2 (DEAD/DEAH box helicase)

Aliases

None

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • obsolete centromere binding (IEA) | GO:0007002
  • iodide transmembrane transport (IEA) | GO:1904200
  • transcription initiation from RNA polymerase III hybrid type promoter (IEA) | GO:0001036
  • negative regulation of regulation of vascular smooth muscle cell membrane depolarization (IEA) | GO:1904198
  • negative regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response (IEA) | GO:0032833
  • transcription from RNA polymerase III type 3 promoter (IEA) | GO:0001035
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16814.g17910(protein)
MYKSNLDSILNQDLGLARFRNMQSMSTTDNVHQVQKTNSNALNQSIKKFAQPYYTSDQVQ
EFASNNTNGAISLKIGDQMQQNASYQVEFKRKLGITYLHEICKNHSQGQIPQLKDLITTY
LLTMLEKMLEMGDLITAVILKEVFSHCLGLGLMNMHVKMRLRPGEEEQQVISINPTIQNA
YDKIIRENESKEYDDNGDLVNCNPDDEMYEGEDHYKAYNLEKEGGFNEYRDKQFPWDSQI
VEINQKVFKNKIFLENQREVINAALSGKDVMALIPTGGGKSLTFQLTALMNNGYTFVIMP
LISLIEDQIESLKQLRIKCVQFSSKFSKKEKQTQFYADLLAGSDPHMKLIYLTPEKLVQS
KSFINVLDKLYSENRIARFIIDEVHCVSHWGQDFRKDYRELQILRMRYATVPMIVLTATA
TIAVKYDIVKHLKLPNIVFFQSSFNRPNLLYEIRDKAKIKKNIAEDIIMLLRDRKYVYQS
GIIYCLSRQECEELCVELSEYDVKCDFYHAKMTEAERKNIQLKWMRNEIHIIIATIAFGL
GINKKDVRFVIHTTIPKSLENYAQECGRAGRDGENANCILYYSYGDRKRLEFFIISNTEN
TAGRKNENLHALYKILEFCEEPYLCQQARYVVAMVESALRKKMDLTVIQICKFLRGKQCV
MSNPNKTTKMDEIKQSYYGRLSEYSEELIKRIVMKLLINKVLKEKFNSYQVESTILVYLI
PGRMFDTFKKGQVRIILTDCIEKETENEYMKLKKKENQDLKKRYKNANGDDEKEVQNDEK
IKKKKKPGRKTLEDQLIDDQNQLEYTKLDQIKVKSILPEEQKEEISQRLEIIRQKLLSKA
QGKIFFLINHIFTNDFIQIMTFILPQATEDLLDNELLDLSNDNKKFLKRYLEIFLNEIRY
FIKLYHLEEIIKNRGGVAYQLMKESSPSKSDENGGLTKFSNCLGVTKIKKEDKFSAFSKQ
HEDEKMQQIKEAIDKVDKGNVSDMDIQEVKQQNQTIQPIKKHMLKRKAFIINPRQNNQKS
KLKKNHVGDKRQFEDSGTHRDYGFSDGEKQANQLQQSVQYQDGSFKWVDEDIPQPGKGQI
LVEVQYSTINPYDRIIFGVNKEEGFVMGADGCGFVRKVGDDVDQNLIGSLVSFTRGGWSR
YAIKDIAQVILYQNNEGFDPRNAANAYVNPLTACGLIDFAKKHNARAVVILAASSQLAKQ
MIKLCRQEGLETVNIVRKDEYVKDLRENYGAKYVLNQESPEFLKDLEPILKDTQATILFE
CLGGDLPGDIFAKMVPKSWMIVYGTLTKKRPSFDAYDFRWNDKNITSFVLNRWLASLEPE
RSYGGV


>Contig16814.g17910(coding)
atgtataaaagtaacctagactccatccttaaccaagaccttggtcttgctaggtttagg
aatatgtagagtatgtcaaccacagataatgttcactaagttcaaaagaccaactcaaat
gcactcaattaatctatcaaaaaatttgctcagccatactataccagtgattaggtttag
gagtttgcgagcaataacactaatggggcaatttcactcaagataggcgattaaatgcag
taaaatgcatcttaccaagttgaatttaaaagaaaacttggaataacttacctccatgaa
atttgcaagaatcacagccagggataaattccccaattaaaagatttaatcaccacatac
cttctaactatgctggagaaaatgttggaaatgggagatttaataactgcagtaatttta
aaagaggtttttagccattgcctgggcctaggcttgatgaatatgcatgtgaagatgaga
ctaagacctggagaagaagaataataagttatttctatcaatccaactatttaaaacgcc
tatgataagattattagagaaaacgaaagcaaagagtatgatgacaatggagacttagtt
aactgcaatcccgacgatgagatgtatgaaggtgaagatcactataaagcttataaccta
gaaaaagaaggaggatttaatgaatatagagataagtagttcccgtgggattcataaatc
gtagaaatcaatcagaaagtcttcaaaaataagatatttctggaaaattaaagagaagtt
atcaatgcagcattatcaggaaaggatgtgatggctttaatcccaactggaggaggtaaa
agtttaactttttaactaacagccctcatgaacaatggctatacttttgttataatgccc
ttaatttcacttattgaagattagatagagtcattgaaataactcagaataaaatgtgtg
cagttctcatccaagttttctaaaaaagaaaagcaaacttaattttacgctgatttatta
gcaggtagtgatcctcatatgaagcttatatatctgactcctgagaagttggtctaatca
aagtcctttattaatgtcctagataaactttactctgaaaatagaatagcaagattcatt
attgatgaagttcattgtgtgagtcattggggtcaagattttaggaaggactacagagag
cttcaaattctaagaatgagatatgctacagtacctatgattgttttaacagcaactgca
acaattgctgtgaaatacgatatcgtaaaacatttaaagcttccaaatatagttttcttt
caatctagttttaacaggccaaaccttctctatgagattagagataaagccaaaataaaa
aagaatattgctgaggacatcataatgctcttaagagatagaaagtatgtatattaaagc
ggtattatctattgtctctcgagacaagagtgtgaggagttatgcgttgagttaagcgaa
tatgatgttaaatgtgatttctatcatgcaaaaatgactgaagctgaaaggaaaaatata
taactaaaatggatgagaaatgaaatacatattataattgctacaatcgcctttggtctt
ggtattaataaaaaagatgtgagatttgtgatccatactactattcctaaaagtttggaa
aactatgcttaagaatgtggaagagctggaagagatggtgagaatgcaaattgtatcttg
tattattcctatggcgatagaaaacgattagaatttttcattatttcgaacactgaaaac
actgctggtagaaaaaatgagaacttgcatgccttatataagatacttgagttttgcgaa
gaaccatatttatgtcaacaagcaaggtatgttgtagcaatggttgaaagtgcattgagg
aaaaaaatggatctcactgtcatctaaatctgtaagtttcttcgtggtaaataatgtgtc
atgtctaatcctaacaaaacaacaaagatggatgagatcaagcagtcttactatggaaga
ttaagtgagtactctgaggaacttataaagagaattgtcatgaaattactaatcaataaa
gttttaaaggaaaaattcaactcttatcaagtggaatctaccatactagtgtatcttata
ccgggaagaatgtttgatacctttaaaaagggtcaggtcagaataatactgacagattgt
attgaaaaggaaactgaaaatgagtatatgaaactcaaaaagaaagaaaatcaggattta
aagaagaggtacaaaaatgccaatggagatgatgaaaaagaagtctaaaatgatgaaaag
atcaaaaagaagaaaaagccaggcaggaaaactttggaagattaactaattgatgactag
aattaattagaatatacaaaactcgattaaataaaagttaagtcaatattacctgaggag
taaaaagaggaaatatcttagagactcgaaataatcagatagaaattactttctaaggct
taaggaaagattttcttcctaatcaatcatatcttcactaatgatttcattcagattatg
acattcattttaccgcaagcaactgaagatcttttggacaatgaattacttgatttatca
aatgacaataagaaatttcttaaaaggtatttagagatcttcttaaatgaaattcggtac
tttattaagttatatcatctagaagagattataaaaaatagagggggtgtcgcctattaa
ttgatgaaagaaagctcccctagtaagtcagatgaaaatggtggtttaacaaaattttca
aattgcttaggagtaactaagatcaagaaagaagataaatttagcgctttcagtaaacaa
catgaggatgaaaaaatgtaatagataaaggaggcaatagataaggttgataaaggaaat
gtatcagatatggatatctaagaagttaaacagtaaaattaaacaattcagccaataaag
aagcatatgctcaaaagaaaagcatttatcattaatccaagataaaacaattaaaaaagc
aaactaaaaaaaaatcatgtaggtgataaaagatagtttgaagattctggaacacatagg
gattatggcttcagtgacggggagaagtaagcaaattagctgcagcagtctgtctagtat
taggatggatcattcaaatgggttgatgaggatataccttaaccaggcaaaggctaaatt
cttgttgaagtgcaatattctactatcaatccttatgatagaataatatttggtgtcaat
aaggaagagggctttgttatgggcgcagatggctgtggttttgtcagaaaagtgggagat
gacgtggatcagaatttgattggtagcctcgtttcttttaccagaggtggttggagtaga
tacgccatcaaggatattgcttaggttattctatattagaataatgaaggctttgatcca
agaaacgctgcaaatgcttatgtgaatccattgactgcttgtggattgatagattttgct
aagaagcacaatgctagagctgtagtcattcttgctgcttcctctcagttggcgaaataa
atgatcaagctttgtaggtaagagggactagaaacagtaaatattgtgagaaaagatgag
tatgtcaaagatttaagggaaaactacggagctaaatatgttcttaattaagaaagtcca
gaatttttgaaagacctagaacccatattgaaagatacttaagcaacaatactttttgaa
tgcttaggaggggatctcccaggagatatctttgctaaaatggttccaaagagttggatg
atagtttatggcacattaacaaagaaacggccaagctttgatgcttacgattttagatgg
aatgataaaaacatcacttcctttgtattaaacagatggctagcatcacttgagccagaa
agaagctatggaggagtctga