Identifiers and Description

Gene Model Identifier

Contig10286.g10974

Standard Name

DEAD22 (DEAD/DEAH-box RNA helicase)

Aliases

None

Description

DEAD/DEAH-box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • obsolete initiation of adrenergic receptor signal transduction (IEA) | GO:0071876
  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity (IEA) | GO:1904217
  • geranyl diphosphate biosynthetic process (IEA) | GO:0033384
  • nucleoside triphosphate biosynthetic process (IEA) | GO:0009142
  • trans-synaptic signaling by lipid (IEA) | GO:0099541
  • gonad development (IEA) | GO:0008406

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10286.g10974(protein)
MDNLLLNIDFNKGGNNKEPAGAKTNNKNKDKYKKNKQKIINKKIERHNKTSDGQPRTFNN
QTQGDRFNKNKPFQQRPQHQSLLVAEKQPELVSEAIVEEQQQQEPVQINQIKRHLGISDK
SKQIKKEYKEALADKTVKFDGDDDYDIELNPILPNEKKVKYQNRDKKQDQEIKEEEKTEQ
QAAKVPFVEEVLVREEAEVFTGDKFSDLPLNDKLKQVLQENNFEKLTNIQKSAIPVILKH
QNVVLKSETGSGKTLAYLVPLLEYLSYISLNKEKITRENGTYCVIFSPTRELCLQIEIEM
KKLLKLFYYVVCGTITGGENPKKEKSRIRKGLTVIICTPGRFLYHLENSSCLNFSRLCYY
IFDEADRILDQGFEREMNKCLSMIKKKVPEKFKTKGDDCFWSDSMRINFVSATINSKVEA
LGSKLMENYEKVGFDLSVSSEMEVVAQIPKQIQQFFVEIPTQYRLLYLLAFLYTHQQEKV
LVFVSNCEHVNFLYHLINNLNWNKFGKREDDQNKNENEEQKVDTLCGGHIYKLHGDMDHN
ERKKNYFGFDKADSAILISTDVASRGLDFKHVEWILQYDLSSQIKEYVNRVGRTARIATT
GQSLCFMMPQEKGYIKHLKTKYGFEIHQRDRFNLIKLFQKKVQELKPEAKLIFKSLKNIE
DEDEQQEAIHRLRYLVRSTMEQDGLNLISMAQIAKNSSTRAYAGHSHEMRHVFEINNLNL
TEFARSFALYKNLMSVGLPQYGKKEEKKRTHSKRDDKNNQSEKTVNMDDEKMFSKRLKKS
QQKGLEKKLNVLTDVNQKERVMGMISDLKRAVYVNEDKVALRKKNFEKARHSVGKKVLSE
FI


>Contig10286.g10974(coding)
atggataatttgctattaaatatagacttcaacaaaggaggcaataataaagagccagct
ggagctaaaactaacaataaaaacaaagataagtataagaaaaataagtaaaagattatt
aacaagaaaattgagaggcataataaaactagcgacggccaaccacgcacttttaataat
cagacttagggtgatagatttaacaaaaataaaccatttcagcaaagaccttaacattag
tcactattagtcgctgagaaataaccagagttggtgagcgaagccattgtagaggagcaa
tagcaacaagaaccagtataaataaattagataaagcgacatttgggaatttctgataag
tcaaagtaaattaaaaaggaatacaaagaagcgcttgctgataaaacagtgaagtttgac
ggtgatgatgactacgatatagaattaaatccaatattgcctaatgaaaagaaagtgaag
tatcaaaatagagacaagaaataggattaggagattaaagaggaagagaaaacagaataa
taagcagctaaagtaccctttgttgaggaagtattagtgagagaggaagcagaagtattt
actggtgataaattctctgatctacctctaaatgataagcttaagcaagtcctataggaa
aacaattttgagaaattaactaatattcagaagagtgcaatccctgttatattgaagcat
tagaatgtagtcttgaaatctgagacaggaagtggaaagactctagcttatcttgtccca
cttcttgaatatctatcatacatttcattgaacaaggagaagattactcgtgagaatggt
acttattgtgtcatattctcaccaacaagagagctctgtcttcaaattgagatagaaatg
aagaagttacttaaactattctattatgttgtttgtggtacaatcactggaggtgaaaac
ccgaaaaaagaaaaatcaagaatcagaaaaggattgactgtgataatatgcacaccaggt
agatttttatatcatttagagaatagttcatgcttaaatttcagtagactatgttattac
atttttgatgaagctgatagaattctagattagggatttgaaagagaaatgaataagtgt
ttgagtatgatcaagaagaaggtacctgaaaaattcaagactaaaggtgatgattgtttt
tggagtgatagtatgaggataaattttgtatcagctacaatcaatagtaaagttgaagca
ttaggatccaaactcatggagaactatgaaaaagttggttttgatttgagtgtttcttct
gaaatggaagttgttgcataaatccctaaataaatctagcagttctttgtagagattccc
acacaatacaggctattatatttacttgcattcctatatacacattaacaagaaaaggtt
ttagtctttgttagtaattgtgagcatgtaaacttcctttatcatttgatcaataatctt
aattggaataaatttggtaaaagagaggatgactaaaacaagaatgaaaatgaagaataa
aaggtagatactctttgtggaggacatatttacaaacttcatggtgatatggatcataat
gagaggaaaaagaattactttggctttgataaagctgattcagcaattctaatatcaact
gatgttgcttcaagaggtcttgattttaaacatgtggaatggatccttcaatatgattta
tcaagtcaaattaaggaatatgtaaatagagtaggtagaactgcaagaattgcaacaaca
gggtaatctctatgctttatgatgccttaagaaaaaggatatatcaaacatctcaagacg
aaatacggttttgaaattcattagagagacagatttaacttaataaagctattctaaaag
aaagtataggaactcaaaccagaggcaaaacttattttcaaatctcttaaaaatattgaa
gatgaagatgaatagtaagaagccattcatagattgagatacttagtcagaagcactatg
gaataagatggattgaatctaatttcgatggcttaaatagcaaagaattcctctacaaga
gcttatgctgggcattctcatgagatgaggcatgtatttgaaatcaacaacctgaatctt
acagaattcgcaagatcatttgcactttacaagaatctaatgagtgtaggcctcccgcaa
tatggcaagaaagaggaaaagaagagaactcactcaaagagagatgataagaataatcaa
tcagaaaagactgtgaatatggatgatgaaaagatgttttctaagagacttaagaagtct
cagcaaaaaggattagagaagaagcttaatgtgctaacagatgttaatcagaaggagaga
gttatgggtatgatcagcgacttgaaaagagctgtgtatgtcaatgaggacaaagtagca
ttaagaaagaaaaatttcgagaaagcaagacatagtgtaggcaaaaaagttctcagcgag
ttcatctga