Identifiers and Description

Gene Model Identifier

Contig1855.g2005

Standard Name

DEAD25 (DEAD/DEAH-box RNA helicase)

Aliases

None

Description

DEAD/DEAH-box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1855.g2005(protein)
MAQLQRSSAMHLNQREVRLLQRHYFLFGQALNIFDQMASKEELIPDYEYELDENHEEEKT
NGANGNKVTAYSGVHSAGFKDLLLKPQLQRAIIECGFEHPSEVQQECIPQAMIGVDVLCQ
AKSGMGKTAVFVLTILHQLPEDPKPISALILCHTRELAYQIKQEFTRFTQFLPEIRTEVI
FGGQPIKDQVNMLKGLKPPHIVVGTPGRIKHLVKEKALDLSGLKIFVLDECDRMLEETDM
RSDVQQIFMATPHQKQVMMFSATFPNECKNIARKFMKNPFEIFIDNQNKMILHGLKQYYI
KLEDNQKIKKLTDLLDSLMFNQVIIFVQSIKHATKLDEILRRDNFPSICIHGDLPQEERI
KRYQDFKKFNHRIIVATDIFGRGIDIERINVVFNFDMPDSSDQYLHRVCRAGRFGTKGLS
ISFISSPTEQETLDAIQKRFEVKIEELPTTIDVSTYMNN


>Contig1855.g2005(coding)
atggcccagctctagagaagctctgctatgcacctcaactagagagaagtcagacttctc
tagagacattatttcctatttggacaagctcttaacatttttgatcagatggccagcaaa
gaagaactaattccagactacgagtatgaactcgatgagaaccacgaagaggaaaaaaca
aatggcgccaatggaaataaggtgactgcttattctggtgtacactcagcaggttttaag
gatctccttcttaagcctcaacttcagagagctattattgaatgcggatttgagcatcca
tcagaggtgcaacaagaatgtattccacaggcaatgataggtgttgatgtgctctgctaa
gctaaatctggtatggggaaaacagcagtcttcgtcctaactattcttcattagttacca
gaggaccctaaaccaatctccgctttaatcctgtgtcacactagagagcttgcttattaa
attaagcaagagttcactagattcactcaatttctaccagaaattagaacagaggttatt
tttggaggttagcccataaaggatcaggttaatatgcttaagggcctcaaaccacctcac
attgtcgtcggaactccaggcagaatcaagcatctcgttaaggaaaaggctcttgatctc
tccggtctaaaaatcttcgttcttgatgaatgcgatagaatgctagaggaaactgacatg
agatccgacgtccaacagatttttatggcaactcctcatcaaaagcaagtgatgatgttt
tcagcaactttccctaacgagtgcaaaaacatcgcaagaaagttcatgaagaaccccttc
gaaattttcattgacaaccaaaacaagatgatccttcatggtctgaagtaatactacatc
aaacttgaagacaatcaaaaaatcaagaagctaactgacttattggactcacttatgttc
aatcaggtcatcatcttcgttcaatctatcaaacacgccactaagcttgacgaaatccta
agaagagataacttcccatccatttgtattcatggagatctcccataggaggaaagaatc
aagagatattaagatttcaagaagttcaaccatagaatcattgtcgctactgacattttt
ggtagaggtattgatattgagagaatcaatgtggtctttaactttgacatgccagacagc
tcagactaatatcttcatagagtttgcagagctggtagattcggtactaaaggtctatca
attagttttatctcatctccaaccgagcaagagactcttgatgctatccaaaagagattc
gaggtgaaaattgaggagctcccaaccaccatcgatgtatcaacttacatgaacaactga