Identifiers and Description

Gene Model Identifier

Contig8879.g9485

Standard Name

DEAD5 (DEAD/DEAH box helicase)

Aliases

None

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • beta-glucoside transport (IEA) | GO:0015759

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8879.g9485(protein)
MQNNYDNLGDKLPTIDWSKQELKPFEKNFYQEHEDVNARSQIETQKVLDDARITVKGTNV
PRPVNSFKEANFPKYIMETLVTLENFEKPTPIQSQGWPVALSGRDMIGIAETGSGKTLSF
LLPAIVHVYAQEVPKRGDGPIALVLAPTRELAMQIDTQCRKFTQPCKIQSLAIYGGVPKD
TQRMALKGGIEILIATPGRLLDFMETGTVRLNKVTYLVLDEADRMLDMGFEKHIQKILSY
VRPDRQTLMWSATWPKEVQDLARSYCNVQPVQIQIGNPGITANNRIDQIIDIVDEFKAYL
KKVNDGSKILVFCETKKGVDELTKQMRYDGLHGVKGIHGDKTQYERDYVIKEFKTGRTYI
LVATDVASRGLDVKDIKYVINYDMPKQIEDYVHRIGRTARAGTTGIAYGLFTRNNVMISK
ELIKLLKEAQQEIPDSLYEMADMARKNKDQKGQYRQWRKTDRAGKFTGNSNYQSEGGYKN
NFSSGGGFKQNNYNNNYQSYQGGNSGYTQPAQTQQAAFTNSTWNRNDGKPSTAPNGDFQH
SYNDQSKLNKAYAGGAPKVFDASALVNTMMSSTSTNAASYNSNSGYYGGNQNYQSNGYNN
HGSGGFNKGYSGGYNNGGAGGQSNNYGSSGYKDSQPFYKSNHGSNDGFKKPSLLDSNQQ


>Contig8879.g9485(coding)
atgcaaaataattacgataaccttggagacaaattaccaactattgattggagtaaataa
gaactaaaacctttcgagaaaaatttctatcaggagcatgaagatgtaaatgccagatca
taaattgaaacctaaaaggtattagatgatgctagaattacagtcaagggtactaatgtg
cctagaccagtaaatagcttcaaagaggcaaatttccctaaatatattatggaaactctt
gtcacactagaaaactttgaaaagcctacccccattcagagctaaggatggcccgtagct
ttgtcaggaagagatatgattggtatcgcagagacaggatccggaaaaactctttccttt
ttgttgcccgcgatcgtgcatgtttacgcctaggaagtaccaaagagaggcgatggtcct
atagctcttgttttagcgccaacaagagaattggccatgcaaattgacacacagtgcaga
aagttcacccaaccttgtaaaattcagtcacttgctatctacggaggagtccctaaagac
acccagagaatggcacttaagggcggcattgaaatattgattgccactcccggtagactc
cttgatttcatggaaacaggcacagtgagactgaataaagtgacttacctagtgttagat
gaggcagatagaatgcttgacatgggttttgaaaagcatatttaaaaaatattgagttat
gtgaggcctgaccgttaaactctcatgtggagtgctacatggcctaaggaagtgcaagat
cttgctagatcatattgcaacgttcaaccagtccagatttaaatcggaaacccaggtatc
actgctaataacagaattgactagatcattgatatcgtagatgaatttaaggcttatctt
aaaaaagtcaatgacggttcaaagattttggtgttctgtgagactaagaaaggagttgac
gagctgaccaagcaaatgagatatgacggccttcatggtgttaagggaatccatggagac
aagacctaatatgaaagagattacgtgatcaaggagttcaagaccggaagaacttatatt
ctagttgctacagatgtcgcatctagaggactagacgtaaaagacatcaaatacgttata
aattatgatatgccaaagcaaatcgaagactatgttcacagaatcggtagaactgcaaga
gctggtacaaccggtattgcatatggattgttcacaaggaataacgtcatgatttcaaaa
gagttgataaagctactaaaagaggctcaacaagagattccagatagtctatatgaaatg
gcagatatggccagaaaaaataaagatcagaagggtcaatatagacaatggaggaaaaca
gatagagctggaaaattcactggcaattcaaattatcaaagcgaaggtggctataagaat
aatttcagtagtggaggaggattcaagtaaaacaactataacaataattatcagagctat
caaggaggcaactctggatatacttaaccagcttaaacttaataagctgctttcactaat
tcgacatggaacagaaatgacggtaagccaagcactgctccaaatggcgatttccaacac
tcctataatgattaaagtaagctaaataaggcttatgcaggaggagctccaaaggtattt
gatgcctctgccttagtaaatactatgatgtccagtaccagcactaacgctgccagctat
aattctaactccggctattacggcggaaatcaaaactactagagcaatggatataacaac
catggcagtggcggctttaataaaggctacagtggtggatataataatggtggagccggt
ggctagagcaacaactacggtagctcgggctacaaggatagttagccattctataaatca
aatcacggatcgaatgacggcttcaagaaaccttctcttttggactctaattaataatga