Identifiers and Description

Gene Model Identifier

Contig1277.g1399

Standard Name

DEAD7 (DEAD/DEAH box RNA helicase)

Aliases

None

Description

DEAD/DEAH box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • positive regulation of gluconate transmembrane transport (IEA) | GO:0035432
  • regulation of cardiac muscle myoblast proliferation (IEA) | GO:0110022
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • blood coagulation, extrinsic pathway (IEA) | GO:0007598
  • opsonization (IEA) | GO:0008228
  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete phosphatidylinositol-4,5-bisphosphate hydrolysis (IEA) | GO:0007203

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1277.g1399(protein)
MYKGIYEMGFENPSPIQEETIPLALENKNVIARAKNGTGKTASYSIPIIQKIDSTKNQIQ
ALVLVPTRELAMQTSLVIKELGKHKKIESMVSTGGTSVKEDIYRLYQTVHVIVGTPGRIL
DLASKGVANLENCNMLILDEVDKLLSVDFKTIVARIIEIMPKTKQIMLFSATYPIEIKEF
QEKYIQEANFINLMEELTLKGVTQYYAYLEEREKLHCLNTLFSKLDINQAIIFCNSAKRV
ELLAKKISQLGYSCFYIHSKMQQSDRNRIYHDFKNGETRCLVSTDLFTRGIDIMSVNVVI
NFDFPKNTETYLHRIGRSGRFGHLGLAINFITEDNKSDLFTIEDELNTKINPIPQDIDKN
LYTV


>Contig1277.g1399(coding)
atgtataagggtatctatgaaatgggatttgaaaatccctcaccaatctaagaggaaacc
atcccacttgctcttgaaaataaaaatgtaattgctagagccaaaaatggtacaggtaaa
actgcatcatactccattccaatcattcaaaagatcgacagcacaaagaactagattcaa
gccttagttctagttcccactagagaacttgccatgcagacttcccttgtcattaaggaa
ttaggaaaacataagaagatagagtcgatggtatctacaggaggaacatcggtgaaagaa
gacatctatcgtctttatcagacagttcatgtcatcgtcggtactccaggtagaatttta
gatctagcttcaaagggagtagcaaatttggagaactgcaatatgctcattcttgatgaa
gttgataaattattgtctgtggatttcaaaactattgttgcaagaatcattgagattatg
ccaaaaaccaagtagatcatgctcttctctgccacctatccaattgaaatcaaggaattc
caagaaaagtacattcaagaagctaattttatcaatcttatggaagaactcactctaaag
ggagttacccaatattatgcctatttagaagaaagagagaaactacattgcttgaatact
ttgttctcgaaactagatattaaccaagccattattttctgcaactctgccaagagagta
gaattgctagctaagaaaatctcacaacttggctactcctgcttctacatccattctaag
atgcaatagagtgatagaaatagaatatatcacgacttcaagaatggagagaccagatgc
ttagtgagcacagatcttttcaccagaggtatagatatcatgtcggtaaacgttgttatc
aacttcgatttccctaagaacactgagacatatctccacagaattggtagatctggcaga
ttcggtcatcttggtttagccataaactttatcaccgaggacaacaagagcgatctattc
actattgaagatgagttgaacactaagatcaaccccattccttaggacattgataaaaat
ctctacactgtctga