Identifiers and Description

Gene Model Identifier

Contig1808.g1958

Standard Name

DEAD8 (DEAD/DEAH box RNA helicase)

Aliases

None

Description

DEAD/DEAH box RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • dicarboxylic acid transport (IEA) | GO:0006835
  • intracellular accumulation of glycerol (IEA) | GO:0006973

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1808.g1958(protein)
MFSLNQQLQRFSASNKDRTEMRDQQIEEAKTSKGKKRDNLVQSTQLQTQDDHLPKSIEIQ
DDMQLNKDEDKKDDRLGEQMTYSQEYYILHREELMQRKKEKEEEAKFGDYSARLVKRPQK
NFLWGFGTQVNDESDDYFRPGQLPTIREIIRFLEAYQMKDITVVNLKATGRDTHENYAIV
ASGFSIKHIYNNAKLLVQKVKELKCPEIVNQLQVSGRRDESWLLVTVKEIQVNFLLHEYR
EELDLEFRWLNSPPQEMVNKWKLYDKMGRRSGQIQNDIQQTSSSHTSGGGHQRKPSFFNS
KKSSTAPADNNNAHENVVTTTTNQTQNVPVIQKEVVQSQPNQGTRGELSMFKQQQPQQTN
NDFMKETSLNKQRLVNSQLPQYNVQDGEFINFPEITNPTIQKLKSKGITSLFPIQMQSFY
PIYNREDLIARDLTGSGKTLAFGIPLIEYLRKNRFLGQRKIQAIVLAPTRELALQVQNVF
AYLKHSENEFRTLTVYGGVSIDDQTRELRYGVDIFVGTTGRVRDHIERGNIDFSAIKSII
LDEADMMLDLGFKDDIEWVRYYSTIPRWVKSVAQQYLKPNYRLVDLAQNLKNKTAKLVQH
LAINLICYGGEGRSIVFTQTKADANSLILSDKIKQDIEVMHGDIAQNQREVTLKRFREGK
FHVLVATDVASRGLDIPNVDLVIQVEPPNDVETYIHRSGRTARAGKMGICITFYTKQTQQ
MIQQIEDQAGIKFKIIGVPQAEDVIKASSKVILKNLELVNSDVIPFFTEAAKQFITQCSG
DPEKALCKALAYISGHYKTALQSRSLLSGQEKQITLELRPLEGSWVNSLNTSIQIFKKFF
PQQMVDHIKGMRAKANQEGIVFDIYEDQCERFLEISAHLRETDSSIDFEVIKCLELPELE
SEDSIKWRGGPSNDNRGGYGGKHNRHQSYSFTNNSTFNPASFKPNDNGYGGGQGFQRPQG
GGRGGYHSRQPSGSHFGPQSHGMRTQGGSRSYMGSRKSSNVANDWDDKSNSKQDNFDKNS
QNLNDFDVKIQTKPPQQQSIKQNFQQNRSQVTGGNSNQPPGNEGRKLYIGNIHYSVKEED
ISALFDDYNLQVVKFSLLKDEKGRHKGAGFVEFETANDAEIAVNELDQTPMGNQPISIEY
MKTGKR


>Contig1808.g1958(coding)
atgtttagcttgaactagtaattgcaaagattttctgcaagcaataaggatagaacagaa
atgagagattagcaaattgaagaggcaaaaacctccaaaggcaaaaagagagataattta
gtttaatctacataattgcaaacataagatgaccatcttcccaagagtattgaaatatag
gatgatatgcagttaaataaggatgaagataagaaagatgatagactaggtgaataaatg
acgtattcttaggagtattacattctgcacagagaagagctaatgcagagaaagaaagaa
aaggaagaggaggctaagttcggtgattattcagctagactagtgaaaagacctcaaaag
aactttctttggggtttcggtacctaagttaatgatgaatcagatgattactttagacct
gggtagttgccaactatcagagaaattataagattcttagaggcatatcaaatgaaggat
attactgtagttaatctcaaagcaactggtagagatactcatgaaaactatgcaatagtc
gcatcaggattctcaatcaagcacatctataacaatgctaagcttctagtttaaaaagtt
aaggagcttaagtgtccagaaatcgtgaatcagcttcaagtgtctggtcgtagagatgaa
tcatggctgttggtcacagtaaaagaaatttaggttaactttttactgcatgagtacagg
gaagaattagatttggaattcagatggttaaacagtcctcctcaagaaatggttaataaa
tggaagctctatgacaaaatgggcaggagatctggatagattcaaaacgacattcaatag
acttcatcctcccacacttcaggaggaggtcattaaagaaaaccatcatttttcaatagc
aagaaatcctcaactgccccagcggacaataacaatgctcatgaaaatgtagtgaccact
actacaaatcaaacacaaaatgttccagttattcagaaagaggtagtataatctcagcca
aatcaagggactagaggggaattatctatgttcaaatagcaatagccccaatagacaaat
aatgattttatgaaagagacaagcttgaataaacaaagattagtgaactcttaattgcct
caatataatgtccaagatggagagtttatcaatttcccagaaattacaaaccccacaatc
taaaagcttaaatctaaaggaatcacgagtttattccctatctagatgcaaagtttctat
ccaatatataacagagaagacttgattgcaagagatcttactggatcaggaaaaacactt
gcttttggcataccacttatcgaatatcttaggaaaaacaggttcttaggacaacgaaaa
atttaggcgatagtattagctcccacaagagaactcgcactacaggtacaaaatgtattt
gcttatttgaaacattctgagaatgagttcaggactttaacagtatacggaggagtctct
attgatgatcaaactagagaattaagatatggtgtagatatctttgtaggtactactggt
agagtaagagatcatattgaaagaggaaacatcgatttttcagctattaagtcaattatc
cttgatgaggcagatatgatgttagacttaggattcaaagatgatatagaatgggtaaga
tattattctaccattccgagatgggtgaaatctgtcgcctagtaatatctaaagccaaac
tatcgtcttgtagatttggcttaaaatttgaagaataaaacagctaaattagtttagcat
ttagccattaacttgatatgctatggaggtgaaggaaggtctattgtttttacataaacc
aaagctgatgctaattcacttatactgtcagataagataaaacaagatattgaagtaatg
catggtgatatcgcttagaatcaaagagaagtaacgctgaaaagatttagagaaggcaaa
tttcatgttttagttgctactgatgttgcatctagaggcttggatattccaaacgtagac
ttagttatttaggttgaacctcctaatgatgttgaaacttacattcatagatctggtaga
acagcaagagctggaaagatgggtatatgtatcactttctatactaaataaacttagcaa
atgatacaatagattgaggatcaagcaggaatcaaattcaagattattggcgtccctcaa
gctgaagatgttataaaggcttcatcgaaagtaattctaaagaatttggaattagtaaat
agtgatgttattccttttttcacagaagctgctaagcaatttattacttaatgctctgga
gatcccgaaaaagcgctttgcaaagctttggcttacatttcaggccattataaaactgct
ctttaaagtagaagtcttttatcaggccaagagaaataaatcactcttgagctaagacct
ttagaaggttcatgggttaattccttgaatacttcaatttaaatctttaagaaatttttc
ccataataaatggttgatcatattaaaggaatgagagccaaagcaaattaagagggtatt
gttttcgatatctatgaagatcaatgcgagagatttttggaaattagtgcacatttgaga
gaaacagattcatcgattgactttgaagtgataaagtgcttagaattaccagaactagaa
agcgaggatagcattaagtggagaggaggtccatctaatgacaatagaggaggctatgga
ggcaagcataatagacattaaagttatagttttactaataacagcacatttaacccagcc
tcatttaaaccaaatgataatggatacggaggtggccaaggattttaaagaccttaaggg
ggaggaagaggtggttatcactctagacaaccttctggatcacatttcggtccttaatca
catggaatgagaacttaagggggttctagaagttatatgggaagtaggaagagtagtaat
gtagctaatgattgggatgataaatctaactccaagcaagacaactttgacaaaaattcc
caaaatctcaatgactttgatgttaaaattcaaactaagcctccttagcagcaatctata
aaataaaacttttagtagaacagatcacaagtcacaggaggcaattctaatcagcctcca
ggaaatgaaggcagaaagctttatatcggaaatattcattactcagtaaaagaagaagat
atcagtgcattatttgacgactacaacctataagttgtcaaattcagtttgttaaaggac
gaaaagggcagacataaaggagcaggatttgtagagtttgaaactgcaaatgatgctgag
atagctgtaaatgaacttgactaaacgccaatgggaaatcagcctatttctatagagtac
atgaaaacaggaaaaagatga