Identifiers and Description

Gene Model Identifier

Contig10120.g10811

Standard Name

DEAD9 (RNA helicase)

Aliases

None

Description

RNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • dicarboxylic acid transport (IEA) | GO:0006835

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10120.g10811(protein)
MQSNRDQEHLRKKPEGKETYLKGEKTLDENGIESKIVLEDKQVYKLVDLYDATEKRSSPM
TEIVVNTKEIEDDLDQQDSDQDMQQKANIKPNSKNSYSIVVPSDKISKISKGIFQQSFTH
TLDKDEESLSQVKKRDLKSESKSRISSQLQFDDCSNEDQQEDHKVGHQQDTKQKGSASCT
DDEADKGSFERFPEISQVTVNNLKSRGIKYLFPVQQQCFYPIYDGEDVIGRDLTGSGKTL
AFALPLVEKFREQKLLGTRKLQAIVLAPTRELAVQVQNEFARLKDRDDEYSTVTVYGGVS
IEPQISALKRGVEFFVGTTGRVLDHIERGNIDFSSIKTVILDEADQMLKLGFKEDVEKIL
LIIKQNITRTLQICMFSATIPQWVKEIAIEHMREQFLFMDLAKDLKNKTAQKVRHLAISC
PYYLKERVLIDLLSVYGEGGRAIVFTQTKADANSLIQNPIFERREIEVMHGDIPQFTREQ
TLKKFREGKIKYLVATDVASRGLDIPNVELIVQVEPPKDVETYIHRSGRTARAGKEGTCI
TFFSNKTSHLMEQIEMTCGIQFDHIQAPSKEEVMRVQSTSAPRDNHGYQGQSREPFQYKS
DTDRSQGIQRNKRDDNGRFVDALDEKRSGFQRNQGFINKENFSNNIQSRGYQGGNSNHSE
KSFPSRGRGHSNFINQQSRNPDQVSMNSRGRGFGGPGYRNMGDGRSDAGFDGKSMKSSAS
FAYSTPQSTPHYSENDSYRVSIPQHRQMDSKQVNGGFHKGFHQNSAAVSREEEKSGQTRV
YMGNLHFACREEELMNLFRENRLRVVSVVFHRDQETGRSRGTGICEFQTARDAQFAIQNL
NGFEYNGRPINFKQYQQPQQFQQERGAIGQNRDFGNGNHHFKKQYNGVEEQEHPRIQPRE
SNRGFEVGMNAQRGRGQMSTNFGNRDQLEQRPQFRGRGQAMPRY


>Contig10120.g10811(coding)
atgtaaagcaatagagactaagagcatctaagaaagaagcctgaaggcaaagagacctat
ctgaagggagagaagactctggatgaaaatggaattgagagtaagattgtgcttgaggac
aagtaagtctacaagttagtggatctgtatgatgccactgaaaagagatcttcaccaatg
actgagatagtagtcaatactaaagagattgaggatgatctcgaccagcaagactctgat
caggatatgcaacagaaagcaaatataaagccaaactcaaagaattcatactccattgtc
gttccatcagacaagatatctaagatctcaaaaggtatctttcaataatcttttactcat
actctagataaagatgaagaaagtctaagttaagtaaaaaaaagagaccttaaaagtgag
tctaagtctagaatcagtagtcaattgcagtttgatgactgctctaatgaagatcagtag
gaggatcataaggtaggtcatcaacaagatacaaagcaaaaaggaagtgcatcttgcacc
gatgatgaggctgataagggtagctttgaaaggtttcctgaaatatcacaagttactgtc
aacaatctcaaatcaagaggtataaagtacctctttcctgtttagcaataatgcttctac
cctatctatgatggagaggatgtgataggcagagacctgactggatcagggaagactttg
gccttcgccttaccattagtagaaaagttcagagagcaaaaactactcggtactagaaaa
cttcaagccattgtcttagctcctactcgggaacttgctgtctaagtttaaaatgaattc
gctagactcaaggatagagacgatgaatatagtacagtcactgtctatggaggagtgtct
attgaaccacaaatatcagctttgaagagaggtgttgagttctttgtcggtaccacaggt
agagtacttgatcacattgaaagaggaaacattgacttctcaagtatcaagactgttatc
ctagacgaggctgattagatgctaaagcttggcttcaaggaagatgttgagaagatcctc
ttaattataaaacaaaacattacaaggacattgcaaatatgtatgttttcagcaactatc
ccctaatgggttaaggagatcgccattgagcatatgagagagtagttccttttcatggac
ttagctaaagacctgaagaataaaactgcttagaaagtcagacacctggcaatcagctgc
ccttattatctgaaagaaagagtccttattgatctattatctgtttatggcgaaggaggt
agagccatagtatttacacaaaccaaagctgatgccaattcattgatctagaatccaatc
ttcgagagaagagagatcgaagtcatgcatggagacattcctcagttcacaagagagcaa
accttgaagaagttcagagaaggcaaaatcaagtaccttgttgccactgatgttgcttca
agggggcttgacatacctaatgttgagttgattgtttaagttgagcctcccaaggatgta
gagacctatattcacagatcaggtcgtactgcaagagctggcaaggagggcacttgtatt
acattcttcagcaacaaaacctctcatctgatggagcaaattgaaatgacttgtggaatt
cagtttgatcacattcaagcacccagcaaggaagaggtaatgagagttcagagtacctct
gctccaagggataatcatggatactaaggtcagagcagagagcctttccaatataaatct
gatactgatagatcttagggcattcaaagaaataagagagatgacaatggcagatttgtt
gatgctttggatgagaagaggtcaggattttagagaaaccaaggttttattaataaagaa
aactttagcaacaatatccaatcaagaggctattaaggtggtaattctaaccattcagaa
aagtcatttccaagtagaggtagaggccacagtaatttcatcaatcaacaaagtagaaat
ccagatcaagtttcgatgaattctagaggcagaggatttggaggtcctggttatagaaac
atgggagatggaagaagcgatgctggctttgatggcaagtccatgaagagttcagcttca
tttgcttacagcactcctcaatcaactcctcactattcagaaaatgactcatacagagta
tcaataccacagcatagacaaatggatagcaagtaggtcaacggaggcttccacaaaggt
ttccattagaatagtgcagcagtttctagagaagaggaaaaatcagggcaaactagagtt
tacatgggcaatttacactttgcttgtagagaagaagaattgatgaatctgtttagagag
aatcgcctaagagttgtgagcgttgtattccacagagatcaagagactggtagatctaga
ggcactggcatctgcgagttctagactgcaagagatgcctagtttgctatctaaaatctt
aatggcttcgagtataatggcagaccaattaatttcaagcaatactagcaaccacagcag
tttcaataggaaaggggtgctattggctagaatagagatttcggtaatggcaatcatcat
ttcaagaagcagtataatggtgttgaggaacaagaacatcctagaatccagcctagagag
tcaaacagaggctttgaggtaggtatgaatgcctagagaggtagaggatagatgtccact
aactttggcaacagagatcagctagagcaaagaccttaattcagaggaagaggtcaagcc
atgcccagatactga