Identifiers and Description

Gene Model Identifier

Contig8598.g9175

Standard Name

DNL1 (DNA ligase 1)

Aliases

None

Description

DNA ligase 1

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • cytoplasmic cyclin-dependent protein kinase holoenzyme complex (IEA) | GO:0000308

Molecular Function

Biological Process

  • positive regulation of chemokine (C-C motif) ligand 5 production (IEA) | GO:0071651
  • dorsal/ventral axis specification, ovarian follicular epithelium (IEA) | GO:0008069
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • transcription from RNA polymerase III type 3 promoter (IEA) | GO:0001035
  • ocellus pigment biosynthetic process (IEA) | GO:0008055
  • intracellular accumulation of glycerol (IEA) | GO:0006973

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8598.g9175(protein)
MKQSTLSFGKPDGSSSAAQSKNKPPAQQKLSFGVGGQLGIKKIGDKNAEAPIDSKLKVLN
EASAKSEIQTDASVKSSTPSKSGVRLTKRTIEEVEESQIVEKVEVHSTTKKIRNNDGEAT
DFVKEEKLMVKSAQKSASASKQTKKDDEEMKEVEQNFPPKDLSKLKPPSSAKYDPIQDAP
FHKGQLVPFGFIARGLSEIELCRGKNSKDAIKEIVANIFRSTILLNPRELPDLFYFFCVK
LGPDYDSPETGIGIELLSNAVAKACGKSLKQIREQFKQEGDYGIVVEKSKGVQKSLGTFF
KKSQETPKDLTFKRVFEAFNKIARQSGNNSQNEKESIILKLLQDATNEEAKYIVRWLQKN
LKTGAAEKTYILALARAIAYTPPNHKGKILNSKLTLGDQLFAEKCEKIELAICEAICEFP
NYGLIIETLLEHGDDLPKLKDRCHITVGIPVKPMLAKPTKGVREVLDRFEQVKFTCEYKY
DGFRGQIHFNRNNPQQMVKIYSRNLEDMTGQYPDVVEFVEKSASQDVETYILDSELVAFD
HVNNRILPFQTLTQRSRKNVTEEDLKTKICICAFDLLYLNGESLLKEPFIKRREILHKNL
HEVQNSFVFAKYKDAEALEAIQEFLGDSIKDSCEGLMIKTLETNATYEPSKRSLNWLKLK
KDYIDSGLGDSLDLVVVGADFGKGKRTGMYGSFLLACYDENLEVLQTVTKMATGLSDEML
AKIYSQLKDLEIDKPPSNLKFKEKNIDVWLVPKYVWEIKCADLSMSPIYCASIGSVEKNK
GIALRFPRFIRERDDKSVEDATSSEQILEYYKSQPSLLKNDGEDDDFDF


>Contig8598.g9175(coding)
atgaaacaatcaaccttgtcttttggcaaaccagatggtagttcttcagctgcttaatca
aaaaataaaccaccagcctagtaaaagcttagctttggggttggaggccagttaggaata
aagaaaattggagataaaaacgctgaagcccctattgattctaaattgaaggtattaaat
gaggcatcagccaaatcagagattcaaactgatgcatcagttaaaagtagcacaccttct
aagtctggagtaagacttaccaagagaacaattgaagaggtcgaagagtcacagattgta
gaaaaggtagaagtgcattcaactacaaagaagatcagaaataatgacggggaagctact
gatttcgtgaaagaggaaaaattaatggtaaaatctgctcagaaatcagcaagcgcatcc
aagcaaaccaaaaaagatgatgaagaaatgaaagaagttgagtagaatttcccaccaaaa
gatctgtcaaagcttaaacccccaagctcagcaaaatatgatccaatataagatgctcca
ttccacaagggctagcttgtacctttcggttttatcgcaagaggtctttcagaaatcgaa
ctttgtagaggtaaaaatagcaaggatgccatcaaggaaattgtagcaaatattttcaga
agtacaatactattaaatccaagagagctaccagatctgttctatttcttctgtgttaaa
ctaggtccagattacgattcaccagagactggtattggtatagaacttctatcaaatgct
gttgcaaaagcatgtggaaaatctctgaagcaaatcagagagcagtttaagtaagaagga
gactatggtattgttgtagagaaaagtaaaggtgtctaaaaatcacttggaacattcttc
aagaaatcataggaaacaccaaaggatttaacattcaaaagagtatttgaggcattcaat
aaaattgctagatagtcaggaaataattctcaaaatgagaaggaatctattatacttaaa
ctactttaagatgcaactaatgaagaggcaaagtatattgtcaggtggctgcagaaaaac
ttaaagactggagcagctgagaaaacatatattttagctttagcaagagcaatcgcttat
actccacccaaccacaaaggtaaaattctgaattcaaaattgactctcggcgattaatta
ttcgctgaaaaatgtgagaaaatcgaattagctatatgtgaagctatttgcgaattccct
aattatgggctaataattgagacacttcttgagcatggagatgatcttccaaagctgaaa
gatagatgccatattactgtaggcataccagtgaagcctatgctggctaaaccaactaaa
ggtgttagagaggtcttagatagattcgaacaagttaaattcacttgtgaatacaagtat
gacggtttcagaggatagatccacttcaacagaaataacccataacaaatggtaaaaata
tactctagaaatttagaagatatgactggctaataccctgatgtggtagagttcgttgaa
aaatcagcaagtcaagatgtcgagacatatatattagacagtgaactggttgcctttgat
cacgttaacaatagaatattaccattctaaacacttacataaagaagcagaaagaatgtg
acagaggaggatctgaagacaaaaatttgcatctgtgcttttgatcttctctatcttaat
ggggaatctctcttgaaagaaccattcataaaaagaagagaaattcttcataaaaatctt
catgaggttcaaaacagtttcgtattcgctaaatataaggatgctgaggcattagaagcc
atttaggaattcctaggtgattctattaaagattcttgcgaaggattaatgatcaagact
ctcgagacaaatgctacttatgaaccatcgaagagatctctgaattggctgaaacttaaa
aaagattatattgattctggtttaggtgatagtttggatttagttgttgtaggagcagac
tttggtaaaggaaaaagaacaggtatgtatggctcttttcttcttgcttgctatgatgaa
aaccttgaggttctttaaactgtgactaagatggccactgggttatcagatgagatgctc
gcaaagatctactcctaattaaaagatcttgaaatagacaagccaccttctaacttgaaa
ttcaaggaaaagaatattgatgtttggcttgtgcccaaatacgtgtgggagatcaagtgc
gcagatctatctatgagtcctatttattgtgcctcaattggctcagtagaaaagaataaa
ggaatagctttgagattccctagatttataagagaaagagacgataaatctgtagaagat
gctacttcaagtgaataaatcctagaatattataagagccaaccctctttgctaaagaat
gatggagaagatgatgactttgatttttga