Identifiers and Description

Gene Model Identifier

Contig9322.g9961

Standard Name

DRE4 (ERCC-5/XPG DNA-repair endonuclease 4)

Aliases

None

Description

ERCC-5/XPG DNA-repair endonuclease 4

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • dicarboxylic acid transport (IEA) | GO:0006835
  • intracellular accumulation of glycerol (IEA) | GO:0006973
  • positive regulation of semaphorin-plexin signaling pathway (IEA) | GO:2001262
  • negative regulation of caveolin-mediated endocytosis (IEA) | GO:2001287
  • T-helper 2 cell lineage commitment (IEA) | GO:0002297
  • positive regulation of macrophage proliferation (IEA) | GO:0120041
  • positive regulation of antigen processing and presentation of polysaccharide antigen via MHC class II (IEA) | GO:0002603
  • regulation of C-C chemokine binding (IEA) | GO:2001263
  • negative regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response (IEA) | GO:0032833

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9322.g9961(protein)
MLFMLGLSTWDGFLRNLQKENMYSQQEQEVVLEGKFPQTLQLILSRYMAITLAKMGSNLS
LSDINMQGLEETKRMIKEQTKNDSNVIIFICDVSNKESVTNAGQTARDAFGSVTLLINNA
GIVSGKNILENSDFMIKKTIEVNTIAHLYTIREFLPDMLALKKGHVVSICSVAGIVCTPG
ASDYAASKFGAFAIDESLRTEMIKQGMFEGVKSQFPFQILDQHYVVRRIIQAIRQEEQLV
VMPWICNVIFLLRAFLPIPVQDIVSKYVGVCKLQLLKASQEECQLVMLQQHLIGLFNRNI
QFSQHGIKAVWVFDGKPPDLKFKTLEKRKENREKAEDQKDEAEEDGDEFKMQKMAQRTVK
VTKPMVEDAKKLIQSMGFPVIQAPGEAEAFCAFLVKQGKAFATVSEDMDSLTFGSHVMIR
GMSMAKQKAGIDLMQIELSKVLNSLKLSYEEFVDLCILCGSDYTSTITGIGSIKAYKFIQ
DYKTIEKVLQVIEQDTHSSKGKKQKYIVPEEYPYQEARELFLKLDYTEELKDIQEQFKWD
KPNEDNIKQFLIKEKNFNEEKVDNGLKKLKKFSPTQGRTQVRLDSFFRVYPGNTPNKNTP
QQIKGKQSGLSVKKGGKK


>Contig9322.g9961(coding)
atgttgtttatgcttggtttaagcacatgggatggcttcctaagaaatctctaaaaggag
aacatgtattcctaacaggagcaggaagtggtcttggaaggtaaattcccttaaacatta
caattaattttgtctagatacatggctatcacacttgcgaaaatgggatctaatctctca
ctttctgatattaatatgtagggattagaggagaccaagcgaatgattaaggaatagact
aaaaatgatagcaacgtaatcatatttatttgtgacgtgtcaaacaaagaatcagtcact
aatgctggttaaacagctagagatgcttttggatctgtgacattactgattaacaatgca
ggcatagtttcaggaaagaacatccttgagaactcagatttcatgattaaaaaaacaatt
gaagtcaatactattgctcatctttataccattagagagtttttaccagatatgcttgcc
ttaaaaaagggtcatgttgtatctatttgctcagtagctggtatagtttgtactccagga
gcatcagattatgccgcttctaagtttggggctttcgctatcgatgaatctttaagaact
gaaatgataaagcagggaatgtttgaaggagttaaatcctaattccctttttaaattttg
gaccaacattatgttgtaagaagaattattcaggctatcagataagaagagcaattagta
gtaatgccttggatatgtaacgtcatatttttacttagagcattcctgccaatcccagtg
caagatattgtttcaaaatatgtcggagtatgcaaactataactcttgaaagcctctcag
gaagagtgctagcttgtgatgcttcaatagcatttaataggattgttcaacagaaatatc
taattttctcagcatggtataaaggcagtttgggtgtttgatggtaaacctccagatctg
aaattcaaaactcttgaaaaaagaaaagagaatagagaaaaggcagaagattagaaagat
gaagctgaagaagatggagatgagtttaaaatgcaaaaaatggctcaacgaaccgtaaaa
gtaacaaaacctatggttgaggacgccaaaaagctcatttaatctatgggattcccagtt
atataagctccaggagaagcagaagcattttgtgcttttcttgttaagtaaggtaaagct
tttgctacagtaagtgaagatatggactccttaacttttggaagtcatgtcatgattaga
gggatgagcatggctaaatagaaggcaggtattgacttaatgcaaatagaactatctaaa
gtattgaactccttaaaactttcatatgaggaattcgttgatttatgcatactgtgtgga
agtgattatacttctactataactggaataggatctatcaaagcttataaatttatctaa
gactataaaacgattgaaaaagttttataagtaattgaataagatacacatagttcaaaa
ggaaaaaagtagaaatacatagttccagaagaatatccttattaagaagcgagagaattg
tttttaaagctcgattatactgaggagttaaaagatattcaagagtaatttaagtgggat
aaaccaaatgaggataatataaagcagtttctaataaaggaaaagaattttaatgaggag
aaagttgataatggcttgaaaaaattaaagaaattttctccaacacagggtcgaacttaa
gttagattggattcatttttcagggtttatccaggaaatacgcctaataaaaatacacct
taataaataaaagggaaataatcaggtttatctgtaaagaaaggtgggaaaaaatga