Identifiers and Description

Gene Model Identifier

Contig17176.g18298

Standard Name

FBL1 (FBL1, rRNA 2-o-methyltransferase fibrillarin-like)

Aliases

None

Description

FBL1, rRNA 2-o-methyltransferase fibrillarin-like

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17176.g18298(protein)
MRGFGGRGGDRGGFRGGRGGDRGGFRGGRGGGDRGGFRGGRGGGDRGGRGGFRGGRGGNG
FKGGRPGLGGGARVIVEPHERFGGVFILRGKDDALLSKNLVPGESVYNEKRVSVDNKESG
EKVEYRVWNPFRSKLASAIVGGIENIYMKPGSKVLYLGAASGTTVSHVADLVGPEGAVYA
VEFSKRSGRDLVNMAKKRTNVIPIIEDARHPQKYRMLVPMVDVIFADVAQPDQARILGLN
AAMFVKNRGHFVISIKASCVDSTKAPEIVYAQEIERLKEEKFRPVERISLEPYERDHIVV
SGVYRPAPEDFPSDNIK


>Contig17176.g18298(coding)
atgagaggatttggaggtcgcggtggcgatagaggtggcttcagaggaggcagaggagga
gacagaggtggtttcagaggtggccgtggaggcggtgacagaggcggtttcagaggaggc
cgtggaggcggcgatagaggtggtcgcggtggcttcagaggaggcagaggtggtaatggc
ttcaagggaggcagaccaggtctcggaggtggagctagagtcattgttgaaccccatgag
agattcggaggagtgttcatcttgagaggaaaagatgacgccctactttccaagaatcta
gtgccaggcgagagcgtctacaacgagaagagagtttcagttgacaacaaggaatctgga
gaaaaggtcgagtatagagtatggaacccattcagatccaagttggcttcagccatcgtt
ggaggtatcgaaaatatctacatgaaaccaggcagcaaggtgctctatttgggagcagcc
tcaggtactactgtatctcacgttgctgatctagttggaccagagggagctgtatacgca
gttgaattctctaagagaagtggaagagatcttgttaacatggccaagaagagaaccaat
gtcattcccatcattgaagatgctcgtcaccctcagaaatacagaatgctcgttccaatg
gtcgacgtcatcttcgctgatgtcgcccagccagatcaagctagaatcttaggactcaac
gctgctatgttcgttaagaatagaggtcacttcgttatttctatcaaggccagttgtgtt
gactcaaccaaggctccagagatagtctacgctcaggaaatcgaaagactaaaggaagag
aaattcagaccagtcgagagaatctctcttgaaccatatgaacgtgatcacatcgtcgtt
tcaggtgtgtacagacctgccccagaggatttcccctcagacaatatcaagtga