Identifiers and Description

Gene Model Identifier

Contig2085.g2242

Standard Name

FMRL1 (Fragile X mental retardation protein 1, putative RISC subunit)

Aliases

None

Description

Fragile X mental retardation protein 1, putative RISC subunit

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • saccharopine dehydrogenase (NAD+, L-lysine-forming) activity (IEA) | GO:0004754

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2085.g2242(protein)
MLHQANLTLRFLHLTSRLGSMVRSETSQRHMAKDNSQLDSATLNCRSYLIRKVLIDTQSG
GMELNANQHQIRWRTSLPTNTSDEEYQTYDLVEAYCRSNRDEIDESIQLVHGWRRATVKS
VKGNYAYLEFDRVHHPDQLSQIYPIRLIRRLSELTGPNPDLFYRTEVLIHPDLHQWVFNL
DKNESSQELLAFNDQLAIITRTSQVYGISLSQDKQRLVVLGPQERLRSATLAVDIFLNHQ
RQVINIDATPQQSKTNPASQKQQARVKNEIFVDSSLVGLIVGQGGMSLKRIQDQYNVKIE
VEQQRRDNQLKKVTIYGNSIKEVQAASSEVNIMKVLIDVPNEHLDYVLGKNDENIEYFTT
KSCVITLDVTKKDDFNHNLVAVGTQQAVDDLKMIVNTHLQYFSQYQQRETLKQNTVKRAM
NVTSEQVQQNNGNEQQHQPVQQQQNRRGGHYQENSNYQQQQNSNQFYRKK


>Contig2085.g2242(coding)
atgcttcatcaagccaacttgacgttgagatttttgcatttaacgagcaggcttggatca
atggtgagatcagagacatcttagagacacatggccaaagacaattcctagttagactct
gccaccctcaattgtaggtcttatttaattagaaaagtgttaattgatacttaaagtggc
ggtatggagctcaatgctaaccaacattaaatcagatggaggaccagtttgccaacaaac
actagcgatgaggagtatcaaacctacgatcttgtagaagcttattgcagatcaaataga
gacgaaattgacgagtcaatctagctcgtgcatggctggagaagagctacagtcaagagc
gtgaaaggcaattatgcatatcttgaattcgatagagtacatcacccagatcagctatca
taaatctatccaataaggcttatccgaagattgagcgagttgacaggaccaaatcctgat
ttattctacagaacagaggtgcttattcatccagacctgcattaatgggtgttcaatcta
gataaaaatgagtcatcgcaagaacttctagcattcaatgactaattagcaatcattact
aggacttcataggtttatggcattagtttgagtcaggataagcaaagacttgtagttcta
ggacctcaagagagactaagatcagccactttagcagtagatatattcctaaatcatcaa
agataagtcattaacatcgacgctacaccttaataaagcaaaacaaaccctgcttcttaa
aaacaataggcaagagttaaaaatgaaatctttgtagacagtagtcttgtaggcttgatc
gtcggctaaggtggaatgtctctaaagagaatataggattaatacaatgttaaaatcgag
gttgagcaataaagaagagataattaactaaagaaggtgactatctacggtaattctata
aaggaagtccaggcagcctccagtgaagtaaacattatgaaagtcttaattgacgtgcca
aatgagcacctagactatgtacttggcaagaacgatgagaatattgagtactttaccact
aagtcgtgtgttatcactcttgatgtgacaaagaaggatgattttaatcacaacctcgta
gctgttggaactcaataggctgttgatgaccttaaaatgatagtcaatacacatctgtag
tatttctctcaatatcaacaaagagaaactcttaagcaaaatactgttaaaagagccatg
aacgtcacaagcgagcaggtgcaataaaataatggaaacgaataatagcattagcctgtg
caatagcaataaaatagaagaggaggacattatcaggaaaacagtaactactagcagcag
caaaactcgaattaattctacagaaagaagtga