Identifiers and Description

Gene Model Identifier

Contig5776.g6186

Standard Name

HDAC5 (Histone deacetylase)

Aliases

None

Description

Histone deacetylase

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

  • negative regulation of plasma cell differentiation (IEA) | GO:1900099
  • negative regulation of inositol biosynthetic process (IEA) | GO:1900089
  • negative regulation of peptidyl-tyrosine autophosphorylation (IEA) | GO:1900085
  • negative regulation of dosage compensation by inactivation of X chromosome (IEA) | GO:1900096

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5776.g6186(protein)
MEGLQTQDRKVFYVYDERMLAHKQYIKPPPEGSTQKVLVNPEIPERISSIYNHLKNEGLL
DQMDKLEVQGLDEIEELIAAIHSQELIDKVRDSCAKLAEGESSNVINPGQGEIYECKDTY
EAAKISAAGAVAGLRDILDGKHEKGYCIIRPPGHHAYHNHPAGFCLFNNVAIATKVALSA
PYNLERVLIFDWDIHHGDGTQALFYDDPRVLFMSLHRTDKLTFYPGYKECLPEFVGEGKG
QGFNVNVAWETGLVVDEVDRSNNTVSTLGNHDYRYACDTLLFPIIEQFQPQLVIVSCGFD
SAIHDFLGFSNVSPLMYQYMTSKLASFCPKLLVVQEGGYNIDYLGQHAQGVTNGLLGNEI
NKVVTQADKDFGISTIEEVDIQKANDYAIENVELTRKHIKEFWKNIEKE


>Contig5776.g6186(coding)
atggagggattatagactcaagataggaaagtgttctatgtatatgacgaaagaatgctt
gctcataaataatatatcaaacccccacctgaaggttcaacttaaaaagttttggtaaac
cccgaaattcctgaaagaatctcaagtatatataatcatctaaaaaacgaaggactctta
gattaaatggataagcttgaggtataaggactagatgaaattgaagaacttatagctgcc
attcattcttaagagctaattgataaagtaagggactcatgcgccaaattagctgaagga
gagagtagcaatgtgataaatcctgggtagggagagatatacgagtgtaaggatacgtat
gaagcagcaaaaatctcagctgcaggagctgtggctggactaagagacatcttagatggc
aaacatgaaaaggggtattgcataattagaccaccaggtcatcatgcatatcataatcat
ccagctggcttttgcttatttaataatgttgctatagcaactaaagttgctctttcagct
ccatacaacttagaaagagtacttatctttgattgggatatccatcatggtgatggcaca
caagctctgttctacgatgatccaagagtcctttttatgtcgttgcacagaactgacaaa
cttactttctatcctgggtataaagaatgcctgcctgagtttgttggagaaggcaaaggt
cagggttttaacgtgaatgttgcttgggaaacaggcttagtagtagatgaagttgataga
tctaataatactgtatcaactcttggtaatcatgactacagatatgcttgtgatactttg
ctattcccaatcatagaataatttcaaccttaattagtaattgtttcttgtgggtttgat
tcagccattcatgatttcctcggattctcaaatgtttctcctttgatgtactagtacatg
acctctaagttagcatcattctgccctaagctgttagtggtttaagaaggaggctacaat
attgattatctaggtcagcatgctcaaggagtaaccaatggtctccttggaaatgagatt
aataaagttgttactcaagctgacaaggatttcggcatttctactattgaagaagtggat
atccaaaaagctaatgattatgctattgaaaatgttgaattaacaagaaagcatatcaaa
gaattttggaaaaatattgaaaaagaatga