Identifiers and Description

Gene Model Identifier

Contig15053.g16037

Standard Name

HELC5 (helicase)

Aliases

None

Description

helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • saccharopine dehydrogenase (NAD+, L-lysine-forming) activity (IEA) | GO:0004754

Biological Process

  • mitotic nuclear envelope reassembly (IEA) | GO:0007084
  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845
  • negative regulation of gibberellic acid mediated signaling pathway (IEA) | GO:0009938

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15053.g16037(protein)
MGDSSEEEQQYITDLKSKYDQSRVKTSTTENNEKQNEQHPYVNLIVENTPNVKKSKVNET
SKSQIKTSQIGQSWHPKHKELIQKVYSQLRPVILSDNTNTKSTLRSPMKSSVNKSFDKKL
KGSNGTVGHTMYQSLDFEPSQNYLRLKKQHSLTLNSKSDRLKAFLNVHSQWKKDKFLSNN
NQVLGSGSKEGRKLNLAEFNSLFKRKELIKKNPNNVPQKKIYNYVIPSERKRDDLRYEIR
MKMLRSSTMSIQRPFSSDGKRKDGIKKTITSINSTYIYQYYNAQTKQKKFGRSNCFQEEK
KRFCITKERFRQKQSLSFQSCLYLESKKRDEKRDDKKSKKERSPSKKVTEEKEVDHVKTR
RMSMAAEKDAVDQEGAFENFPQITPKTIESLKKRGITKLFPVQYQSFNHVWNRKDLIVRD
LTGSGKTMGFALPMVEYFRKHKLFGTGKIQGMCLAPTRELALQVSKEFNALKHSENEFNV
LTVYGGVSIEDQTYQLRRGVDIFVGTTGRVLDHMERKNFNFTDLKTIVLDETDQMLKQGF
KEDVERIMATIKEKAPKNLQVLLFSATVPFWVKQVAKEQMAPDFMMIDLAKDLHNKTSKT
VNHLSINCPYQNRMSALADILVCYGGIGQTIVFCSTKAEANSLLLSDKIKQDIEVMHGDI
AQNQREVTLKRFKECKFNVLVATDVASRGLDIPNVDLVIQVEPPKEVETYIHRAGRTARA
GRTGTCITFYGKKHQGLITMIEQKAGIKFQKIGVPQPEDVIKASSRDVIKNLDQVVDQVL
PLFEDAADLLIEKYGNDPKKALQVTLAYLSGHYKQVMSTRSLLTGQENYVTAEIKLNNAF
NSLSFVWGILKRYLPDGMVNSIRGMRMFKDNKGVVFDVPDDSIAKFEDTFKHLFDEKKID
FHVGITKELPDLKEDNDFQQPSSGYGGYGNRQGGGYGQSSGGYGQQRNQSYGNNQGGNQF
DGYQRNQSAPSRGNNDERTVFVGNLGFNTQEKEIEGLFTKERLNPSRLRLLNGPDGQFKG
AAFVEFNSKEEAEKACQLDGRQIGDRKIRVNPAGNKPNPR


>Contig15053.g16037(coding)
atgggagattcaagcgaagaagagcagtaatacatcactgacttgaagtctaaatacgat
taatcaagagttaagacctctacaactgaaaataatgaaaaataaaatgagcagcatcca
tatgtcaatcttattgtagagaatactcctaatgtaaaaaaatcaaaagtcaatgagact
tcgaaatctcagattaaaacttctcaaattgggtaatcttggcatcccaaacataaagag
ttgatataaaaagtttactcgcagctaagaccagtaatactttcggataatacaaatact
aagagcactctaagatcaccaatgaaatcgtcagtgaacaaatcattcgataaaaagctc
aaagggagcaacgggactgtaggacatacaatgtatcaaagtctagacttcgagccttca
taaaattatcttagactaaaaaagtagcatagtctgacattgaatagcaaatctgatcgt
ttaaaggccttccttaatgtgcatagtcagtggaagaaagataaattcctctcaaataat
aactaagtcttagggagtgggtctaaagagggaagaaaattaaacctagctgaattcaat
tcgcttttcaaaagaaaggaattaatcaaaaaaaatccaaacaatgtgccttaaaagaaa
atctacaattatgtgattccatctgagcgcaaaagagatgacttgagatatgaaattaga
atgaaaatgcttaggagtagtacgatgtcaatccagagaccattctctagcgatggaaag
cgcaaggatggcataaagaagactataacatcaattaactctacttacatatactaatac
tataatgcccagactaagtagaagaaattcggaagatcaaactgtttccaagaagagaag
aagagattctgcatcaccaaagagagattcagatagaagtaatccctatccttttaaagc
tgtttatatttagaatctaaaaagagagacgaaaaaagagatgataaaaagagcaagaaa
gaaagatcaccatcaaagaaggttactgaggagaaagaagtagatcatgttaagaccaga
agaatgagtatggcagctgaaaaggatgcagttgattaagaaggtgcctttgaaaacttc
ccataaattacacccaagactattgagagtctcaaaaagagaggtattacaaagttgttc
ccagtttaatactaatcattcaatcatgtctggaataggaaagatcttatagtcagagat
ctgacaggttcaggcaaaaccatgggcttcgctctgcctatggtagagtacttcagaaag
cataagctatttggtactggaaaaatttaaggaatgtgtttagcaccaacaagagagtta
gccctttaagtatcaaaggagtttaatgctcttaagcattctgaaaacgaattcaatgtt
ttgacagtctatggaggagtctcaattgaggattaaacctactaattgagaaggggtgtt
gatatttttgtcggaacaactggtagagttttagatcatatggagagaaagaactttaac
ttcacggaccttaagacaatcgtattggatgagaccgattaaatgctcaaataaggattt
aaagaagatgttgagagaattatggcaactattaaggaaaaagcccctaaaaatctataa
gtacttttattctctgctacagtgccattttgggtgaagcaagttgcaaaggaacaaatg
gctccagatttcatgatgattgatctggctaaggacttgcataataagacatctaagact
gttaatcacttgtccatcaattgcccatactaaaatagaatgtcagcactagctgatatt
ttagtttgctatggaggtatcggctaaactattgtattctgttctaccaaagctgaggct
aactcactcttactttctgataagattaagtaagatattgaggtcatgcatggagatatc
gcttaaaatcaaagagaagtcaccttgaaaagattcaaggaatgcaaattcaatgtttta
gttgctactgatgtcgcttcaagaggtttagatattccaaatgtcgaccttgtcatccaa
gttgaaccacctaaagaagttgagacctatatccatagagcaggtagaactgctagagca
ggtagaacaggaacctgcattactttctatggaaagaagcattaaggacttatcactatg
attgaataaaaagctggtattaaattctagaaaattggagtcccacaaccagaagatgtt
attaaagcatcatcaagagatgttataaagaatcttgattaagttgtagattaagtccta
cctctatttgaggatgctgctgatttgctaattgaaaagtacgggaatgatcccaagaaa
gcacttcaagtcacacttgcctatctatctggacattacaagcaagttatgagtacaaga
agtctattaacaggccaagaaaactatgtgacggcagaaattaaactaaacaatgcattc
aattcactttcctttgtttggggtatcttaaaaaggtatctaccagatggaatggtgaat
tcaattagaggcatgagaatgtttaaagacaataagggtgttgttttcgatgtaccagat
gattcaattgctaagtttgaagacactttcaagcatctattcgatgaaaagaaaattgac
ttccatgttggaataactaaggagcttccagatttgaaagaagataatgatttctaataa
ccatcaagtggttatggaggatatggtaacagataaggtggaggttatgggcaatctagt
ggtggatatggccaacagagaaaccaatcatatggcaataactaaggaggcaactaattc
gatggctaccaaagaaattaatcagctccatcaagaggaaataacgatgaaagaacagta
tttgttggaaatcttggttttaacacttaagaaaaggaaatcgagggtctatttacaaaa
gaaagactaaatccaagcaggctaagactcttaaacgggcctgatgggcaatttaaagga
gcagcttttgttgaatttaactcaaaagaggaagcagaaaaagcatgctaattagacgga
aggtaaattggggatagaaaaattagagttaacccagcaggcaataaaccaaacccaaga
tga