Identifiers and Description

Gene Model Identifier

Contig7392.g7899

Standard Name

HIR1 (Putative histone chaperone HIRA-like)

Aliases

None

Description

Putative histone chaperone HIRA-like

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7392.g7899(protein)
MRLGKVDWVNHSKMPILSVDVQPNGFRYVTGGTDHKVCIWNLLPVISEKYEKIGQKNKNA
QEEGKAAHSGDVEMRSNEEVSHEKGTNDPIEDSDGYKDDIRIMESLFESEKKRSQRLLAI
LDAHANPVNCVRWNSIGTLFASASDDGSVLLWEYVGEQLANVFQKMSMQNMASTGHQKRQ
FFEESKGGNQQQLGDEEPDQEQYLEEWRNKRSWRSHKGGVIDVAWCPDNIHFASCGTDSQ
IIIQSINEPSAIKFIDQKANGLCFDPFGKFMASQSSEDRSLIIWRIQDFKNLSKECEHSS
YYKQAMSQSLFRRLSWSADGQFISTTAGKVGSHHIAPLIERSSWKQMASLSGHNKTICTS
RINPRLFKNPNTSKELNMDTGEYQEVLSCYSVVALASIDSTLSIWKPYMDKPFAVVLDIF
KMGVTDLSWGFNGNILLASSNDGHVFSVHFKPGVLGHPITEMEKQIIIEKKYGSTILNDY
KKHTKLVCQSLGSLNTATNMPLSQSGKVSANLTGNLLKQSQQETINKNGKKKIVPVMIKQ
YNESANINPFLNPFQNQMIIDQSAANLKTAQNQKIEASQNLANSKPQQDIIQPQVIKQAH
NEELKQDSLLSNENQAPKLPPFSKTFGQTSCDQITTTAKSQIVSSNQQSMIQQQQQPIPN
QKTTAPTVMIQPQVQQIQQTTQIVQQSNNLQKLQLEEEKESLIEQSARKGKKSKKRKPDN
QQEAISQQQVVGGTQFGQNFAQISRQLQFTGSNQQNIQFVASKENLNQLERIFELTKDII
TAIPIEEHQLLNSIKHKEQMQFSLPAQDSFSEELKVIISNVDLNAFNRRAEVKILNQDNV
YISQTAIEREFVVLTCVCHSFFILYTNLGQLQIFSTRTTQLIRGGLIQEGICFLECSEES
MSFTTLNLKGQLNIYKMKNVDYPSVDTCMLLWSASVIEILRIQSQLAQQLDPNAKVFVRK
LKLVRDGGVMVFLTDNTSFEYDINTKMWRQLSNTNELANSLKQADDQKFGNNQNIQRDQQ
IHSQNDGKISSIIKQLEHQNLEDQLQVLEQDANMINQEEEQRFLQNHQNPYQLETMLRKI
NGLQESMQIYERLHMKGELLYALRMYTTMIIAVGDFVKLKDLVLDYRLLTTAEEEQSLAS
NSDQQKQYTLHGLIINQDTALHNLLSLMSDEQNEDSRDHQNPANIINSINDKSRVINLDE
KRYFQVCGMDKREIFQKSIMPVLQTQATSDSLLKQYLSKVIQKIAELNSSGQHQQRNYLM
GGNQGQNKQRRGSKHHIIQNTNSSNQMLQDQEMLMVQGPQGSNGQQVTYQVIQPSQIGLM
LPSISSCLPSYVVDHKNQDMSQIHQQMMLQLNQPSWPYMQISGDQIMQTQVITHPQTLVQ
AQQLNQHMQQNPKDHQ


>Contig7392.g7899(coding)
atgagattgggaaaagtagactgggttaatcactcaaaaatgccgattcttagtgttgac
gtccaacctaacggcttcagatatgtcactggaggaacagatcataaggtttgtatttgg
aatctgctacctgtgatttctgaaaagtatgagaaaataggacaaaagaataaaaatgcg
caagaggaaggcaaagctgctcattcaggagatgttgaaatgagaagtaatgaggaagtc
tctcatgagaaaggaacgaatgatccaattgaagattctgatggttataaagatgatatt
aggataatggagtcacttttcgagtctgaaaagaagcgctcatagagattactagcaatc
ctggatgctcatgctaatcctgtcaattgtgttagatggaatagcattggtacacttttt
gcaagtgcatcagatgatggcagtgtactgctttgggaatacgtaggggaacaattagca
aatgtctttcaaaaaatgagcatgcaaaacatggcatccactggccatcagaaaagacag
ttctttgaggagtcaaaaggcggtaatcaataataattaggtgatgaggagcctgaccag
gaataataccttgaagagtggagaaataaaagatcttggaggtctcataaaggaggtgtg
atcgatgttgcctggtgtcctgacaacattcactttgcctcctgcggtactgactcctaa
atcattattcaaagcatcaatgagccatctgctatcaaatttatcgactaaaaagcaaac
ggactctgctttgatcctttcggaaagttcatggcttcttagtcatcagaggacagatca
ctgataatatggagaattcaagatttcaaaaatctgagtaaagaatgcgagcacagcagc
tattacaagcaggcaatgtctcaatctctattcagaagactgtcttggtctgctgatggg
taatttatttcaactacggcaggtaaagtaggaagtcatcatattgcgccattgatagag
agatcatcttggaagtaaatggcttcactcagtgggcacaataagactatatgcacttct
agaataaaccctaggctgtttaagaatcctaatacaagcaaagaattaaatatggataca
ggagagtatcaagaagtgctctcatgttatagtgtggttgcactagcctctatagactca
actttatccatttggaaaccatatatggataagccttttgcagtagtcttagatatcttt
aaaatgggagtaacagatttgagttggggatttaatggaaatatactcttagcaagttca
aatgatggccatgtctttagtgttcattttaaaccgggtgtattaggacatccaatcact
gaaatggaaaaataaattatcattgaaaaaaagtatggctctactattctcaatgactac
aaaaagcatactaagctggtatgctaatctttaggatcgttaaatacggcaacgaatatg
cccctctcttaatctggaaaagtctcggcaaatcttactgggaatttattaaaataatct
taacaagagactatcaataaaaatggaaagaaaaagatagttccagtcatgatcaaacag
tataatgagtcagcgaatattaatccattcttgaatccattctaaaatcagatgattatt
gatcaaagtgctgctaatcttaaaactgcataaaatcaaaagattgaagcaagccaaaac
ttagccaatagcaagccttaataagatataatatagccataagtcattaaataagcacac
aatgaagaattaaagcaggattcattattatctaatgaaaattaagcaccaaaattgccc
ccattcagtaaaacatttgggtaaacttcatgtgactaaataaccacaactgctaagagt
taaatagtctcttctaattaatagtcaatgatttaacagtagtaatagcctatacctaac
tagaagactactgctccaaccgtcatgatttagcctcaagtttagtaaattcagtagaca
acttagatagtctagtaaagcaataatctacaaaaactgtaattggaggaggagaaggag
agtttgattgagcagagtgccagaaaaggtaaaaagtctaagaagaggaagcctgacaat
caataagaagctatctcttagtagtaagtagttggaggaacataatttgggcagaatttc
gcatagattagtcgtcaacttcaatttactggatctaatcagcaaaatatctaatttgtt
gcatcgaaagagaaccttaatcaactagagagaatatttgagcttactaaggatatcata
actgctatcccgattgaagaacatcaattgctcaatagcataaagcataaggagtagatg
tagtttagtttgccagctcaggactctttctcggaggaacttaaagtcataatatctaat
gttgatttgaatgctttcaatcgaagagctgaggtaaaaattcttaactaggacaatgta
tatatttctcaaacagccatagaaagggagtttgtggtcttgacttgcgtttgccactcg
ttctttattctttacactaacctagggcaactttaaattttcagcacaagaacgacacaa
ttgattagaggtggcttaattcaagaaggcatatgcttccttgaatgctctgaagagtca
atgtcctttactactctgaatctgaaaggataactcaacatatataagatgaagaacgtt
gattacccctcagtagatacatgcatgctactatggtcagcttcagtaatagagatactc
agaatttagagtcagcttgcctaataattagaccctaatgctaaggtgtttgttagaaaa
ttgaaattagtgagagatggcggtgtaatggtatttttaactgataatacctcttttgaa
tatgacattaacactaaaatgtggagatagctttcaaataccaatgagctagcaaattct
ttgaaacaggccgatgattagaagtttggaaataattagaatatttaaagggatcaatag
attcactcataaaatgatggcaaaatatcttcaattatcaagcaacttgaacactaaaac
ctagaggatcagctctaagtattagaataggatgctaatatgatcaactaagaggaagag
tagagatttttacaaaatcattagaatccttattaacttgaaaccatgcttagaaagata
aacggtttgcaagagtcgatgcaaatctacgaaagattgcacatgaaaggtgagttatta
tatgctcttagaatgtatactacaatgatcattgctgttggcgactttgtgaaactcaaa
gacttggtcttagactatcgtcttctaaccacagcagaagaggagtaatctctagcttct
aattctgatcagtaaaagtagtatactcttcatgggctcattatcaaccaagacactgct
ctacacaacttgctaagccttatgtcagatgagtagaatgaagactccagggatcatcaa
aacccagcaaacatcataaactctatcaacgataagagtagagttataaatctcgatgaa
aagaggtatttctaggtatgtggcatggacaaaagagagatattctaaaagtctataatg
cctgttttgcagacctaggcaacaagtgatagtttattaaagtaatatctgtcgaaggtt
attcaaaagatcgcagaacttaattcaagtggttaacatcaataaagaaattatctaatg
ggcggtaatcaaggctaaaataagtaaagaagagggtcaaagcatcatattatttagaat
acaaattcttctaactagatgctgcaagatcaggaaatgctaatggtccaaggaccctaa
ggtagtaatggctagcaagtcacttatcaagtaatctagccctctcaaataggtctaatg
ctcccctcaatctcaagctgtctgccttcttatgtggttgatcataaaaaccaagatatg
tcctagattcatcaacaaatgatgctttaactcaattaaccaagctggccatatatgtaa
atctcaggagactaaataatgcaaacccaagtcattactcatcctcaaactctagttcaa
gcctagtaattaaactaacatatgtagtagaaccctaaagatcattagtga