Identifiers and Description

Gene Model Identifier

Contig14654.g15612

Standard Name

HIS11 (histone variant H1.1)

Aliases

None

Description

histone variant H1.1

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14654.g15612(protein)
MPLVHSYFEMIEDALLTLADRKGSSRQGIWKCISTKFPEADYKQFLIRFKKVGENQNIVK
AKGQRLRLSPNYRLKLLKALEKGQSVKQTQKTKATMKKNSKRKSARQNKKAKSGKAKKSS
RKVKAAGKGKSAGKKMTKKTGNSKKAPGKNVKGSKMAQKKKQNKQAMNNKKATMNKKKNS
RAGAKAKSGPKTKQAKGNGMKGGMKGKGKKGSGAAGKRNQHKQTDDAHDDGDLAHDGHQN
AHHDNAHQDEHKSHTPSRNERSSRRNSAPQTSNKKNLKSNAKASGRKSGAGGRKSDMRKS
KASKDIKKKGKK


>Contig14654.g15612(coding)
atgccactcgtacactcatactttgaaatgattgaggacgctctcctcactctagccgac
agaaaaggttcatcaagataaggtatctggaaatgtatttcaactaaattcccagaggct
gactacaagcaattcttgatcagattcaagaaagtcggtgaaaactagaacatcgttaag
gctaaaggctaaagactaagactcagtccaaactacagattgaagttgcttaaagcactt
gagaaaggtcaatcagtcaagcaaactcagaagaccaaggctactatgaagaaaaactca
aagagaaagtccgccagacaaaacaagaaagctaagtcaggaaaagctaagaaatcctcc
agaaaggtaaaggctgcaggaaaaggtaaatcagctggcaaaaagatgaccaagaaaaca
ggaaacagcaagaaagcacctggcaagaatgtgaagggatccaagatggctcagaaaaag
aagcagaataagcaagctatgaacaacaagaaagccacaatgaacaagaagaagaactcc
agagctggcgccaaagctaaatcaggaccaaagactaagcaagccaagggtaatggaatg
aaaggaggaatgaaaggaaaaggaaagaaaggatcaggggctgctggcaagagaaaccag
cataagcagactgatgatgcccatgatgatggagacctagctcatgacggccaccaaaat
gctcatcatgataacgcacatcaagatgagcacaaatcccatactccttcaagaaacgag
agatcatcaagaaggaactcagctcctcaaacctcaaacaagaagaacttgaaatcaaat
gccaaagcttcaggcagaaagtctggtgctggtggaagaaaatccgacatgagaaagagc
aaggcctccaaggacatcaagaagaagggcaagaagtga