Identifiers and Description

Gene Model Identifier

Contig2946.g3149

Standard Name

PCNA2 (Proliferating cell nuclear antigen)

Aliases

None

Description

Proliferating cell nuclear antigen

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of DNA recombinase mediator complex assembly (IEA) | GO:1903873
  • negative regulation of telomeric loop disassembly (IEA) | GO:1904534
  • positive regulation of acetylcholine metabolic process (IEA) | GO:0060409

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2946.g3149(protein)
MFEAKLADGQTLKRIVEAIKDLVTDVNIDATPTGLSLQAMDSSHVALVNLHLSMEGFEKY
RCDRNLTLGISITNLAKVMKLVNVNDSITLKCEDEPTYLTIVCVNQKLDRTTQFNINLIT
LDSEHLGIPETEYTSEITMNSNEFSKLCKELYVLSETVEFEISSTYVKFSVEGEVGSGSI
KIQTGGGYNGADDGVTKEEETVKLSFALRYLNLFNKAYTLSTHVKLSMAADTPLVVEYEV
EMLGTLKYYLAPKITDGGQ


>Contig2946.g3149(coding)
atgtttgaagccaaattagctgacggtcaaactttgaagagaattgtggaagcaatcaag
gacttagtaactgatgtgaacattgatgctactccaactggattatcactctaagctatg
gactcttcccatgttgctttagtaaatttgcacttatctatggaaggctttgagaagtac
agatgtgatagaaatctaaccctaggtattagcatcactaatttagccaaagtcatgaag
cttgtgaatgtaaatgactctattactttgaaatgtgaagatgaaccaacctacttaact
attgtttgtgtgaattagaaactggacagaaccactcaatttaatatcaacttgattact
cttgactcagagcacttaggtatcccagagactgaatacacctcagagatcactatgaac
tctaatgaattctctaagctttgcaaggaattgtatgtccttagtgagacagttgaattt
gaaatttcttcgacttatgtcaaatttagtgttgagggagaagttggatcaggaagtata
aagattcaaacaggtggtggctacaatggagctgatgacggtgtaacaaaagaggaggag
actgttaagctatcttttgcactgagatacttaaacttgtttaacaaagcttatactctt
tctactcatgtgaaactgtcgatggctgctgacactcctttggttgttgaatatgaagtt
gagatgcttggcactttgaaatactacttagcgccaaagattactgatggaggtcaatga