Identifiers and Description

Gene Model Identifier

Contig17059.g18172

Standard Name

PIWI12 (Piwi-like 12)

Aliases

None

Description

Piwi-like 12

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17059.g18172(protein)
MFRDKQTLIANFYEFLLEGKSPTNKTHKYCLYQYKLTTVPKIDRDKFLKIRHLLIQPNKL
NDGENSDETKTSVSQDDKMENDADVNKDDNMVNKESSANNNSKVQSQLDEQKSSQKQQSA
DEFILEKYLGKYFKFLKFNQKYISEINQKSYFHPCLLYSVKFIQQLISYSKTIKDKQFTV
TITFDKEIDLKNSEYGQTIMQQYFRDYLFNQVIKKCYPNYKRLGYTQIFNPERVTNLKEY
DIEIWSGFRMEVKPIEQIPMLNIDIDYLVVRLETVLDVINEIKKIYVTYGESQACQERLQ
KDIRKAFVGKAVVTRYNNNVYKIKDVDFNQNPECYFVQTIVDIANNKKKLIKKSYTQYLE
EKYYKTITDKEQPLLVTSDNICLVPEFCMVTGLSEETWNSPSQLNQVRDVVNATKPDVMR
RIVDIKKDFFDVLYKNQSQFNFDEIKISNFPHIMEGVKLEMPTVQMAKLPQGPRVEISTK
NVEEFERKIFQQLPIKMFEAPPLEQWALFYHEEDESLGNKLVHTLNESLTTFNYHAKPIQ
IIKVKGNKFQDWHQSIRDNLSVTVIAAVILIPGTKGLPNQLYSDIKRILIKEIPVPSQAI
LSQTIEKSKSALFSVCNKLIMQICAKIGGEPWAISELPYFYDCTMVSGYYITSNLISYVC
SLNSKATRYWSKCLSVTNEQGDSQIVQQQTCLKLSSLFFESLLAFKLRMNCCPSQIFLFT
NQRYQAKEEIQQELDAIQQILSKMQLGAKITLIQVDPSVQTHVKMAVVEQPNRLIPISHG
LVIIEKNNTQNQQSSPAFPCKLPLDFYLSSYYNKDINQTTVTQYRVIKDEICCQSGVENG
YEQLFQLIHRLCFLYFNHIGPVDMPACLKYAFKQAQILQEFGFKKNQILSAHEHYDKNIL
GLYYL


>Contig17059.g18172(coding)
atgttcagagataaacagactctcattgcaaatttttatgagtttttattggaagggaaa
tcccctacaaataagactcataagtattgtctctatcagtacaaattgacaactgtacca
aagatagatagagataaatttctcaaaataagacatttgctcattcagccaaataagctc
aatgatggtgaaaattctgatgagactaaaacttcggtctcataggatgacaagatggaa
aacgatgctgatgtcaacaaagatgataatatggttaacaaggaatcaagtgcaaataac
aatagcaaagtttaaagctaattagatgagcaaaaaagcagctaaaaatagcagtcagca
gacgagttcattcttgaaaaatacttaggcaagtatttcaagttcctcaaatttaactag
aaatacatatcagaaattaattaaaagtcatatttccatccatgtttactctattcagta
aagtttatccagcagctgattagttatagtaaaactataaaggataaacaatttacagta
accataacatttgacaaagaaatcgatcttaaaaatagtgaatatggctagacaataatg
cagcaatattttagagactatctatttaactaggtgattaaaaaatgctatccaaattac
aagagactgggatatacccagatattcaacccagaaagagtaacaaacttaaaagaatat
gacattgaaatttggtcgggattcagaatggaggtgaagccaatagagtaaatacccatg
ctaaacattgatattgattaccttgttgtaagattagaaactgtattagatgttatcaat
gagattaaaaagatttatgtaacttacggagaaagttaggcttgctaagaaaggctttaa
aaagatattaggaaagcctttgttggcaaagcagtcgttacaaggtataacaataatgtt
tacaagataaaagatgtagactttaatcagaatcctgagtgctattttgtgcaaactata
gtagatattgctaacaacaagaaaaagcttattaagaaatcatatacttagtatcttgag
gaaaaatactataaaacaattactgataaggagtagccactgcttgtgactagtgacaat
atatgcttggtgcctgagttttgcatggtaacaggtttgtccgaagaaacttggaattcc
ccaagttagcttaactaagtaagggatgtggttaatgctactaagccagatgtaatgaga
agaattgttgacataaaaaaggacttctttgatgtactctacaagaatcaaagttaattc
aatttcgacgaaattaaaatatcaaactttccacatattatggaaggggtaaaacttgaa
atgcctacagtttaaatggcaaaattaccatagggtcctagagttgagataagtactaaa
aatgtggaggagtttgagaggaagattttctagtaactacctataaaaatgtttgaagca
cctccacttgaataatgggcactattctatcatgaagaagatgaaagtctagggaataaa
ttagttcatactcttaatgaatcattaacaactttcaattatcacgcaaaaccaatctaa
ataattaaagttaaaggaaataaattctaggattggcattaatcaattagggataattta
tcagttacagtcatagctgcagttatattgattcctggtaccaaaggtctcccaaattaa
ttatactctgacatcaagcgaattttaatcaaagagatacctgtgccttcttaagctata
ctctcttagacaatagagaaatctaaaagtgcgctattttcggtatgcaataaactcata
atgcagatttgcgctaaaataggaggggagccttgggctattagtgaattaccatatttc
tacgactgcacaatggtttcaggatactatattacaagcaacttgatatcctatgtttgt
tcactaaattcaaaagccaccagatactggtctaaatgcttgagcgtaacaaatgaataa
ggagatagctaaatagtgcagcagtaaacttgcttgaaattatcgagtttatttttcgag
tctctcttagcctttaaattgagaatgaactgctgcccaagtcagatatttttatttact
aatcaaaggtatcaggcgaaagaagagattcagcaagagttagatgctattcaatagata
ttaagcaaaatgcaactaggagcgaaaataacattgatttaagtagatccaagcgtttag
actcatgtgaaaatggctgtggttgaataacccaataggttaataccaatttcacatggt
ctcgttatcattgaaaagaataatacttaaaattagtaaagttcacctgcatttccttgc
aaactaccccttgatttctatctctcctcatattataacaaagacattaatcaaacaaca
gtgactcagtatagagtgataaaagatgagatatgttgtcaatctggagttgaaaatggc
tatgagcagctattttaactgattcatagactatgcttcctatattttaatcatattggc
ccagttgatatgcctgcttgtctgaaatatgcttttaaacaggcataaattttgcaagaa
ttcggatttaaaaagaattagatattaagtgcacatgaacactatgataaaaatatacta
ggtctttattatttatga