Identifiers and Description

Gene Model Identifier

Contig18911.g20064

Standard Name

POLD11 (DNA polymerase delta catalytic subunit)

Aliases

None

Description

DNA polymerase delta catalytic subunit

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • obsolete activation of MAPKK (pseudohyphal growth) (IEA) | GO:0000192
  • negative regulation of DNA recombinase mediator complex assembly (IEA) | GO:1903873

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18911.g20064(protein)
MEHRYSAYKSENEFEDAPEFLKGPDLSGRQNVRRPPCPSINPNTQNIEFMQIDVDYYTDL
PLSMKNQQSQYMSEDQSKEREKEEKAVIRMFGITQQGNSVMCHVHNFTSYFYVEYLPHVH
QLTPIDLERIKNELNNLENGAKMVMSIEMIKKSTVMHYQENQKTFLKIYTRLPRHVNLLR
TKFENRHYVFSQKEDLFQQITFESNLPYALRFMIDNEIVGMSWIRVDEGKYKIRSQNFKI
TNAQIEIDVENFNDIQCLPCEGDYQNLAPLRILSFDIECSAEKGRFPLAQQDPIIQIANI
VKIQGEKEPFVRNVFTLQECAPIVGSQVNSYKSEQKMLEAWRDFLVEVDPDIITGYNIVN
FDFPYIINRAQALQMNKYAKFSRILDSVSKIKSNTFSSKALGTRETKDINIEGRVQFDML
QVILREHKLRSYSLNSVSAQFLGEQKEDVHHSIISDLQNKNEFTRRRLAVYCLKDAYLPL
RLMEKLMCLFNLTEMSRVTGVPISYLFTRGQQIKVSSQLYRKAKEYDLVIPVDKGAPMEG
KYEGAVVIEPTRGFYTDPVATLDFASLYPSIMMAHNLCYSTLIPNNRVKNYNPEMYVKTP
NGDYFMKQTVKKGLLPMILEELISARKRARQELAKATDPFVKAVLDGRQLALKISANSVY
GFTGAQVGQLPCLAISSSVTAYGREMIEATRAYVLNKYCKKNGYEFDSQVIYGDTDSVMV
KFGVESITEAMKLGQEAASYVSQFFEHPIKLEFEKVYCPYLLMNKKRYAGLLWTKPDKYD
KIDAKGIETVRRDNCGLVKEAVQKSLDLLLINKDKDKALDFCKGIISDLLQNRIDLSLLV
ITKGLGKKTSKPETDDKSNKPQGSTNQSYHGKQAHVELAERMRKRDEASAPSQGDRIAYV
MIKAAKGSKGYEKSEDPLYVLQHNLAIDFQFYLDHQIKLPLLRLFEPVFSNAEQLLFQGE
HTRAIYIPKVGNTMTGLGKFAVVKKQCLGCKNVMGNNDDDCVCKNCQPKKKQIYIERKQE
LNLYEKTYADLWVQCQRCQGSLHEDILCTSRDCPIFYRRLKAKKNLEENQEILAGFLDW


>Contig18911.g20064(coding)
atggaacacagatatagcgcttacaaatctgaaaatgaattcgaggatgcccctgaattt
cttaaaggtccagacctctcaggcagataaaatgttagaagacccccatgcccctccatc
aatccaaacacataaaatattgaattcatgcagattgatgtggactactatactgacttg
ccattgagcatgaagaattagcagtcccagtatatgagtgaggatcaaagcaaggaaaga
gaaaaagaggaaaaagctgtaatcagaatgtttggtattactcagcaaggaaactcagta
atgtgccatgttcacaactttacctcctatttctatgttgagtatctgcctcacgtacac
caactgactccaattgacttggaaaggattaagaatgaacttaacaatcttgaaaacggt
gctaagatggtcatgtcaattgaaatgataaaaaagtctaccgttatgcactatcaagag
aatcagaaaacatttttgaaaatatataccagacttcccagacatgtaaacttgctaagg
actaaatttgagaatagacattatgtattcagtcaaaaggaagatctcttctagcaaatc
accttcgagtctaatttgccttacgctctcagattcatgattgataacgagatagtagga
atgtcttggattagagtcgatgaaggcaagtataagattagaagttaaaattttaaaatc
actaatgcttagatcgagattgatgtagaaaacttcaatgatatacagtgcctgccatgt
gaaggagattattaaaatcttgcacctcttagaatactttcatttgatattgaatgttca
gctgagaagggtagattccccctagcttagcaagatccaattatctaaattgctaacata
gttaagatacaaggtgaaaaagaaccatttgtcagaaatgtatttacactccaagaatgt
gccccaattgttggttctcaagtcaactcctataaaagtgaataaaagatgctagaggcc
tggagagatttcttggtagaggtagacccagatattatcactggctataacatagttaac
ttcgacttcccctatatcatcaatagagctcaagcattgtaaatgaataagtatgccaaa
tttagtagaatcctagattcagtgtcaaagataaagtctaacactttttcttcaaaggcc
ttgggcactagagaaactaaggacattaatatcgagggtagagtttagttcgacatgctg
caagtgattctcagagagcataaacttagaagttattcccttaattcagtcagtgctcag
ttcttaggtgaataaaaggaagatgtgcatcattctatcattagtgacttgcaaaataaa
aatgagttcacaagaagaaggctggctgtgtattgcttgaaagatgcctatctaccattg
agacttatggagaagctgatgtgtctgttcaacttgactgagatgtctagagttacagga
gtgccaatatcttatttattcacaagaggccaacaaatcaaggtctcttcctagttatac
agaaaggcaaaggagtatgatttagtgatcccagtagacaagggagctccaatggaagga
aagtacgaaggtgcagtcgtcattgagccaactagaggattttatactgatcccgtagca
acattggatttcgcttcactttatccatcaatcatgatggctcataatctatgctactct
actctaattccgaataacagagtcaaaaactacaatccagaaatgtatgtgaagacgcca
aatggagattactttatgaaacagactgtgaagaagggattactccctatgattctagag
gaacttatctcagctcgtaagagagctagacaggagttagctaaagcaacagatccattt
gtaaaggccgtgctagatggtagataattagccttgaaaatctcagctaactctgtgtat
ggtttcacaggagcctaagttggatagttgccttgtcttgctatcagtagtagcgttaca
gcctacggtagagaaatgatcgaagccacaagagcttatgtgctaaataagtattgtaaa
aagaatgggtatgagtttgacagccaagttatctacggagatactgattcagtaatggtt
aagttcggagttgagtctattacagaggccatgaagctaggacaggaagcagctagctac
gtctcgcagttctttgagcatccaattaaacttgaatttgagaaagtctactgcccctac
ctgctgatgaataaaaagagatacgctggattgctgtggactaagcctgacaaatatgac
aaaattgatgctaagggtattgaaacagtcagaagagataactgcggacttgtgaaggaa
gctgttcagaagagtctcgacctgctcttaattaacaaggacaaggataaggctctggat
ttctgcaagggtattattagtgatttactgcagaaccgtatagatctctcgcttttggtc
atcactaagggacttggtaaaaagactagcaagccagaaacagatgataaatcaaacaag
ccttagggctcgaccaattaaagctaccatggcaagcaggctcatgttgagttggcagaa
cgtatgagaaagcgtgatgaggcatctgctccctctcaaggagatagaatagcctatgta
atgataaaggcagcgaaaggtagtaaagggtatgaaaaatcagaagatcctctgtatgtt
ttgcagcataacctggcaattgacttttaattctacctggaccatcaaattaaattgcca
cttttaagactctttgagccagttttttcaaacgcagaatagcttttgttctagggcgaa
cacacgagagctatctacatacccaaagtgggaaacacaatgactggacttggcaaattt
gcagtggtaaagaagcagtgtctcggctgcaagaatgtaatgggcaacaatgacgatgat
tgtgtgtgcaagaattgccagcccaaaaaaaaacagatatacatcgaaagaaagcaggaa
cttaacctctatgagaagacctacgctgatctctgggtgcaatgccaaagatgccaaggt
tcattgcatgaggacattctatgcaccagcagagactgccctatcttctatagaaggctc
aaagccaaaaagaacttagaggaaaaccaagagatacttgccggatttttggattggtga