Identifiers and Description

Gene Model Identifier

Contig5351.g5729

Standard Name

POLD13 (DNA polymerase delta catalytic subunit)

Aliases

None

Description

DNA polymerase delta catalytic subunit

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • negative regulation of DNA recombinase mediator complex assembly (IEA) | GO:1903873
  • obsolete activation of MAPKK (pseudohyphal growth) (IEA) | GO:0000192

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5351.g5729(protein)
MVETNKFASNDKKCEEAPAFLKTIDLSNQNNIQRKQLPKYDQAKDKVEFMQIDVDSYCAP
APVRMYGITANGNSVMVHIHNFVPYFYVEVDPKKYTITLEDLNKIKVDLNNWNKGEECVR
QVELVQKQSVLGYQESQGLFLKIYTTLQKYVIQLRSLFENQSFSVKGVNCFSHVTYESNL
PYSLRFMIDYGIVGMQWIRIEPGKYRRRIGMKTSSCQLEIDVEDPQNLITLPFEGEYSRI
APLRILSFDIECSADKGRFPQPNLDPVIQIANIVKTHGDQEPFVRNVFTLLKCASIIGTQ
VYSYQSEQELLINWRNFIKEVDPDIITGFNIMNFDFPYIVNRAVALGIKNYPTFSKLHDQ
VARIKCGTFSSKALGTRDTKEINIEGRVQFDMLQFFLREYKLRSYSLNSVSAEFLGEQKE
DVHHSIIYELQNKNEFTRRRKANQNNMLIPTERGISNEGKFEGALVIEPNRDFFQVPISI
LDFASLYPSIMLAHNICYSTLIPPKAIKFYKTEDYIKTPNGDHFIKAEVKRGILPLILDE
LIIARKKARKELAEEKDSFQRAVLDGRQMALKVAANSVYGYTGAQIGQLPCLAISSSILQ
WLNLELKQQQKRFNWDKKLLIMLLYSLPSPLDQNLKKRYAGLLWTKPNKFDCIDAKGIET
VRRDNCGLVQETVQTSLNMLLIDRDPNKALDYCKGIISDLLQNRIDLSLLVITKGLGKKS
KSEEKESTGPPTLKDLKGATKGYQQKQAHTELAERMRRRDEATAPSQGDRVAYVMIKGAK
DSKSYEKSEDPLFALQNNLPIDYQYYLEHQIKQPLLRLFEPIFPNAEIQLFSGEHTRNIY
VPKIQSSTGLGKYAIVQKQCLGCKTILSKQQVEQSVLCNNCEPKRRSIYIERKVEQCINE
KAYADLWVQCQRCQGNLHEDILCTSRDCPIFYRRIKAKKQLEENMEILKGFEDW


>Contig5351.g5729(coding)
atggtcgagaccaataaattcgcttcaaacgataagaagtgtgaggaggctcctgctttc
ttgaaaacaatagatctatcaaactaaaacaatattcaaagaaagcaattgccaaagtat
gactaagccaaagataaagtcgagtttatgtaaattgatgttgactcatactgtgctcca
gctccagttagaatgtatggtattactgccaacggaaattcagtaatggtacatattcac
aactttgttccatatttctacgttgaagttgaccctaagaagtacaccattactcttgaa
gatctcaataagataaaagtagacttaaacaattggaacaagggcgaagaatgtgttcga
caagttgagttagttcaaaaataatcagtcctaggctattaagaaagctaagggctattt
cttaagatctacactacgcttcagaaatatgttattcaactaagaagtttatttgaaaat
tagagtttttctgtaaaaggggttaactgcttctctcatgtcacttatgagtcaaattta
ccttattcattaaggtttatgattgattatggcatagtgggaatgcagtggattaggatt
gaaccaggaaagtatagaaggagaataggaatgaagacatcatcctgccaacttgaaatc
gatgtcgaagatcctcaaaatctaataactttaccctttgaaggcgagtactcaagaatc
gctccattgagaatattgagttttgatatagaatgctcagcagataaaggaagatttcca
tagccaaatttagatccagtcatataaatagcaaacatagttaaaactcacggagattaa
gaaccatttgtaagaaatgtatttacactcttaaaatgtgcatcaattattggaactcaa
gtatattcctattaatctgagcaagaactattaataaattggaggaatttcatcaaagaa
gttgatccagatataattactggctttaacataatgaatttcgacttcccctatattgta
aatagagctgttgctttaggtattaagaactatcctacattcagcaaattacatgactaa
gtagcaagaataaaatgcggcacattctcatcaaaagccttaggcacaagagatactaaa
gaaataaacattgaaggtagagtataatttgatatgcttcaattcttcttaagagaatac
aaattaaggtcatactctctgaactctgtatcagctgaattcttaggtgagtaaaaggaa
gatgttcatcacagtattatttatgaacttcaaaacaaaaatgagtttacacgaagaaga
aaggcaaatcaaaataatatgcttataccaactgagagaggaatttcaaatgaagggaaa
ttcgagggtgcccttgtgatagagcctaatagggactttttccaagtgcctatttctatt
cttgattttgcatccttgtatccttctattatgcttgctcataatatatgctattctact
ctgataccaccaaaagcaataaaattttacaagacagaagattatattaaaactcctaat
ggggatcattttataaaagctgaggtaaaaagaggaatcttaccattaattctagatgaa
ctaattatagcaagaaaaaaagctagaaaagaactcgccgaagaaaaagattcattctag
agggcagttctagatggaagatagatggcattaaaagtagcagcaaatagtgtctatgga
tatacaggagcttaaattggctagcttccatgcttagcaatttcctctagtattctataa
tggttaaatttggagttaaaacagtagcagaagcgctttaattgggacaagaagctgctc
attatgttactttattctttaccaagcccattagactagaatttgaaaaagagatatgct
ggcttattatggactaaaccaaataaatttgactgtatagatgctaagggtattgaaaca
gtgagaagggataattgtggtcttgtttaggaaacagtttaaacaagcttaaacatgcta
ctaatagatagagatccaaataaggctcttgattattgtaaaggtattatcagcgatctt
ctttaaaatagaattgatttatcgcttcttgttataactaaaggtcttggtaaaaaatct
aaatcagaggaaaaagaatcaactggtcctccaacattgaaagatttaaaaggcgctacc
aaaggttatcaacaaaaataagctcatacagaattagccgaaagaatgagaagaagagat
gaagcaactgccccctctcaaggcgatagagttgcttatgtaatgattaaaggtgcaaaa
gatagtaagtcatatgagaaatcagaggatccattattcgctcttcaaaataacttgcca
atagattatcaatactatttagagcattaaattaagtagcctttgttgagattgtttgag
ccaatatttccaaatgctgagatttagcttttctctggagagcatactagaaatatttat
gtcccaaaaatataatcttcaactggtttagggaaatatgcaattgtttagaaatagtgc
ctaggatgcaaaacaattttaagtaaataataagtagaatagagtgtattgtgcaataat
tgtgagccaaagaggagatcaatttacattgaaagaaaagtagaataatgcattaatgag
aaagcatacgctgatttatgggtttaatgctaaagatgctaaggaaatttacatgaagac
atcttatgtacgagcagagattgtccaattttttatagaagaatcaaagccaaaaaatag
ttagaagaaaatatggaaattttaaaaggatttgaagattggtga