Identifiers and Description

Gene Model Identifier

Contig4689.g5014

Standard Name

POLD4 (DNA polymerase delta subunit 4)

Aliases

None

Description

DNA polymerase delta subunit 4

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4689.g5014(protein)
MSNLNHYFKQDKKGIKSNQYGGISPRLMKQSQVSTALHSKSNQHPSHQQQQFVSQEDQQR
QFMLNELVMFDANPDFGPCKGISRMQRWNNSNNLGLNPPDHIPGFIEQTGDNKSFLEQYM
I


>Contig4689.g5014(coding)
atgagcaatcttaatcactatttcaagcaggataagaaaggaattaaatccaattaatat
ggaggaatctcgccacgattaatgaaataatcgcaggtttcaacggctttacattcaaaa
tccaactaacatccatctcatcagtaacaataatttgtttctcaggaagattagcaaaga
taatttatgcttaatgaacttgttatgtttgatgccaatccagattttgggccttgtaag
ggtatctctagaatgtagagatggaataattcaaataatcttgggctcaatccccctgat
catatacctggctttatagaacaaaccggagataataaaagttttttagagcaatacatg
atttga