Identifiers and Description

Gene Model Identifier

Contig10274.g10960

Standard Name

PRIM1 (DNA primase small subunit)

Aliases

None

Description

DNA primase small subunit

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10274.g10960(protein)
MDESDPQTQVRSSEMIQDLEFTVELLKIYYDKAFPYDKMFDWLSYFKVSKKQNRLQSLED
GVDSEYFYNREFSFTLENDVYCRYLCFKNPTDLKDALVSRTPHKIDIGAIFNIPPKNHLI
TEKKVFIPLEKEMVFDIDMTDYDNVRTCCTGAKVCKKCWAYMACATQVINNVLTQDFGFS
SLLWVFSGRRGIHCWIGDESARQMTNEMRSAVTEYLFLATGNEMGGGFDLGYPLHPMHQR
AYKFLSKRFEQIVIIDQDLLAHEAHQKKFLKLLPQNVANELQSRMNRAQTSQEKWKLYKD
TLDKLHASGKTASQKHDPIMIKLVFTYLYPRIDANVSKGINHLLKSPFCIHPKTGKVCVP
FDPMTVDNFDIQNVTTLSKVINDIGNSKDGSIPCLKESLAVFQTFLNKLKADSQNELKKY
KEKEQSTDF


>Contig10274.g10960(coding)
atggatgagtctgatccctagactcaagttagatcatctgaaatgatctaggatttggaa
ttcactgtggaattacttaagatttactacgataaagctttcccatacgacaagatgttc
gattggctttcatatttcaaggttagcaagaagcagaataggttacagtcattggaagat
ggagtagactcagagtatttctacaacagagagttttccttcactcttgagaatgatgtt
tactgtaggtacctttgctttaagaaccctactgacctaaaggatgctcttgtctctaga
actccacataaaatcgatattggggcaattttcaacattccgccaaaaaatcatttgatt
acagaaaagaaggtgttcattcctctagagaaggaaatggtgtttgatatcgatatgact
gactatgataatgttagaacatgctgcactggagctaaagtttgcaaaaaatgctgggct
tacatggcttgtgccacttaagttatcaataatgtcctcactcaagattttggattttca
tctttactctgggttttctctggtcgtagaggtatccattgctggataggtgatgaaagt
gcaagatagatgacaaatgagatgagatctgcagtcacagagtatctcttccttgcaact
ggcaatgagatgggtggtggctttgatttgggataccctcttcacccaatgcatcagaga
gcttacaagtttttaagcaagagatttgaatagatcgttatcattgaccaggatttgcta
gctcacgaagctcatcagaagaaattccttaagctattgccttagaatgtggctaatgaa
cttcaatctagaatgaacagagcttaaacaagttaggaaaaatggaagttatacaaggac
accctagataaattacatgcttcaggaaagactgcaagttaaaagcatgatccaattatg
atcaagttggtgttcacctatctgtatccaagaatcgatgctaatgtcagtaagggcata
aaccatttgctcaagtcgcctttctgtatccatcctaaaacaggcaaggtctgtgttcca
tttgaccccatgacagtcgacaatttcgatattcaaaatgtcacaactctttccaaagta
ataaatgatatcgggaatagcaaggatggaagtatcccttgtctcaaggaatctttagcc
gtgttccaaacattccttaataaactcaaagcagactcatagaatgaactcaaaaaatat
aaagaaaaagagcaaagtacagatttctga