Identifiers and Description

Gene Model Identifier

Contig16673.g17760

Standard Name

RAD513 (DNA repair protein)

Aliases

None

Description

DNA repair protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16673.g17760(protein)
MKQAKKQQQTQVQQHAPLADAETQLSGQDDEMDMEPAYNEIDRLEQHGINAADIGKLKTA
GLCTVLAVLMCTKKEMLNIKGITDQKAEKIYEAASKIETMGYVSGLQILEKRKKIKKITT
GSRQFDMLLQGGVESQGITEAFGEFRTGKTQLAHTLCVTAQLPKSQGGGEGKVLYIDTEN
TFRPERIKQISQRYQVDPQEVLNNIMVGRSFTVDSLSTLITQAAGAMVEEQFALMIIDSI
MAPFRVDYSGRGELSERQQVLGKVLSKIQKISEQFNIAVFMSNQVMADPGAGMTYAADPK
KPIGGNILAHASTTRLYLRKGKGEQRVCKIFDSPSIPEGECIFQISEGGIIDATD


>Contig16673.g17760(coding)
atgaaacaagcaaaaaagtagcagcaaacttaagttcaacagcatgcaccacttgcagat
gctgaaacctaattgagtggccaagatgatgaaatggacatggaaccagcatacaatgaa
atagataggctagagcagcatggaattaatgctgcagacattggcaaactaaagactgct
ggactttgcacagtacttgctgttttgatgtgcactaagaaagagatgctgaacataaag
ggaatcacagattaaaaggctgagaagatttatgaggcagcatcaaaaatagagactatg
ggctacgtaagtggactccaaatccttgagaagagaaaaaagatcaagaagatcacaact
gggtcaagacaatttgacatgcttttatagggtggagttgaaagtcagggcattaccgaa
gcatttggagaattcagaactgggaaaacctaacttgctcatacactctgtgtgactgca
taattgcctaagtctcagggtggaggagaaggaaaagtcctctacattgacactgaaaat
acttttcgcccagagagaatcaagcaaatttcttaaagatactaagtggatccccaagaa
gttctcaacaacattatggttggaagatctttcactgtggatagcttaagcaccttgatt
actcaggctgctggggcaatggttgaagagcaattcgctcttatgatcattgactctatt
atggcacctttcagagtggattactcaggaagaggtgagctttcagagagacaacaagta
cttgggaaagttctgagcaagattcaaaagatcagcgaacagtttaatatcgctgtattt
atgtcaaattaagtaatggctgatcctggagcaggaatgacatatgcagcagaccctaag
aaacctataggaggcaacatcttggcacatgcttctacaacgagactctacctaaggaaa
ggaaagggagagcaaagagtttgcaagatttttgactctccttcaattcctgagggagaa
tgcatcttctagattagtgaaggaggcatcattgacgctacagactga