Identifiers and Description

Gene Model Identifier

Contig13657.g14567

Standard Name

RDRP1 (RNA-directed RNA polymerase 1)

Aliases

None

Description

RNA-directed RNA polymerase 1

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • obsolete NGF/TNF (6 C-domain) receptor activity (IEA) | GO:0005027

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13657.g14567(protein)
MEKVNDFQSSEYWGKFNRPKSSFEKKIFFVQQFVDSLTRHRTKKEENKKAYKDIEETRIK
EAMILNEVYDFSLGTINYQVIEDNQVERQYIPIFPDFYKPHGFTKERIKDVQFKFKLQED
RFKNLTVEGLKYKNLQVSFTHLADDNKSTQYSLDIKIDQVSKISGCYIDNDVVQLILTLK
KPCRVFAKLPKIDLRDSKWKEVNSPFTFLQQDKQFMTYWNLKQVIFLQGKFDLAMNLDEL
QTKFKDLDRGTKLNFQNNFDMRVLQDMNLYLEHEKLLQRNQQFFELIKQLIIPAKFGIMS
ILSTQKTSIFSDHLNQLMENLLNRKFNGEYLFKASEDEFTLDYFIQPGNIQAHKEVRKVL
YIMDQICNSVKHFEKNSDSLQKDIEEEYQDQNDLKQRRVYQTPTLTLFHQNYKEQTHRVL
RYNHLYKDFFFRLILVNDDGEKTHFGNFKGKPVLEKMKDIMKDQFYIGGTKGQVLNYSNS
QLKNHSVWMLCDTNIPDIIKERIIYQLGTFSKDEGYLKMFARIGQCFSTTKYVCRLNEKE
NVRYIDDLKVKKTDDNEDKNGFYCYTDGCGNISESLCNKIAESHNLEKCSAFQIRLGGIK
GVLMKKIYSMQDGGIYVDEKNKLQGDMVEIRPSQIKFKCDQWDLEVIRCATFSQGYLNRQ
VILLLNCLGVPEDIFISLQKQQLENLDVNKVMEDLHRRSHVFLMNRRKVKSSSKQSQELS
QEIDLFFGPSRVFSAVFKNALLKSVTQYHKFKEENKDDNLNFDRKVFRMEKEPIFQAILQ
NMVLGLAVNLKKKARIRIKNSCVLIGVIDETGSLNDGEIFVKINRSSYDLDNAQDIISEE
LDKNYDNMTKNTNAQVIFTYEDQQISGKVIVTKNPCSHPGDIRLLTAIGPEDERCQVFEE
LINVIVFPSKGYRPEQHKMSGGDLDGDVYMCIWDDQIVSQIPESCCKTGQCTRQEGIQPP
AVYKKFEEDSNVNSDNIVDHMANYFERDNLGHLAHLHLGLCDQEGVKGPFRQEMIELSWY
MSIAVDFAKHGKSVEPHKYQHIERKLNQWPDFMEKHDQFRKTVQSPLVLGKLYRAVNCKS
FYRKLMEYDYEMSILLKYELNETIIKKREEDQKTYSRDFINYLIPAFDRIVVPLKEKLRD
LMVMYNIAHESELFCTNLTFSLNDENMDKIVGDPGQKDEDAVRALNHRLQEYLTQYKNEF
QKCIKDLECVPGIFAKAVYYATYYNEDNIPYQQFSTAQIWAKSDKTTQNLKDLLIRFEEH
WKAHISQEMSSRHLKMQEAIKDFSHYKKVLEKDTKSSKDKLRLLLEVRQFFSIPWIICHE
YLID


>Contig13657.g14567(coding)
atggagaaggttaatgactttcaaagttctgaatattggggaaaatttaatcgccctaaa
tcaagctttgaaaaaaagatattttttgtataataattcgttgattcacttacgagacac
agaactaaaaaggaggagaataagaaggcgtataaagatatcgaagaaactagaataaaa
gaggcaatgatcttaaatgaagtctatgatttttcacttggaactatcaattattaagtt
atcgaagacaactaagtagagagacagtatataccaatattcccagacttttacaaacca
catggattcacaaaagaaaggataaaggatgtttaatttaaattcaaattgcaggaagat
cgattcaaaaacctaactgttgaaggtcttaaatacaaaaacttgcaagtatcatttacc
catttggctgatgataacaagagcacgcagtattctctggatattaagattgattaagtc
tcaaagatttcaggatgctacattgacaatgacgttgtctaactgatcttaacactcaag
aaaccttgcagagtctttgctaaactgcctaaaattgatcttagagattctaaatggaag
gaggtgaattccccatttacttttctttaataggacaaatagtttatgacttattggaat
ctgaagtaagtcatatttcttcagggcaaatttgaccttgctatgaatctggatgagctc
caaacaaaatttaaagatctggacagaggtacaaagcttaacttccaaaataatttcgac
atgagagtactttaagatatgaatctctaccttgagcatgaaaaacttttgcagagaaac
taataattctttgaacttattaagcaactaatcattcctgccaaattcggaattatgtca
atcctatctactcaaaagacctctatattttcagatcacctgaattagctaatggaaaat
ctactcaataggaaatttaatggagaatacctgtttaaagcatctgaagatgagttcact
cttgattactttatatagccaggaaatatacaagctcataaggaagtgagaaaagtactc
tatataatggattagatttgtaattcagtgaaacattttgaaaaaaactcagatagctta
taaaaagatattgaagaagagtatcaagactaaaatgacttgaagcagagaagagtgtat
caaacacctactttgactttattccattaaaattacaaggaacaaactcacagagtacta
agatacaatcatctctacaaagactttttcttcagattaatcttagtaaacgatgacggt
gaaaaaacacactttggaaactttaagggaaaacccgttttggaaaaaatgaaggatatt
atgaaagactagttttacattggaggtactaaaggataagttctaaactattcaaattct
caattgaaaaatcattcagtttggatgctatgcgatacgaacattccagatatcatcaaa
gaacgaattatttactaacttggaaccttcagcaaggatgaaggatatcttaagatgttt
gctcgtattggacagtgcttctcaacaacgaaatatgtttgcagattgaatgagaaggag
aatgtacgatacatagatgatttaaaggtgaaaaagactgatgataatgaagataaaaat
gggttttattgttacactgatggctgtggaaatatttcagagtctctttgcaataagata
gcggagtctcataatctcgagaagtgttcagctttctaaatcagacttggaggcataaaa
ggagtacttatgaagaaaatatactcaatgtaagatggcgggatctatgttgatgaaaaa
aataagttgcaaggcgatatggttgagatcagacctagttagatcaagttcaaatgtgat
taatgggatttagaagtaattagatgcgcaactttcagttagggctatcttaatagataa
gttatattacttttgaattgtttgggagttcctgaggacatatttatttcattacagaag
tagtaattagagaatttggatgttaacaaagttatggaggatttgcatagaaggtcccat
gtgttcttaatgaatagaagaaaagttaaaagcagtagcaagcaatcacaagagctttca
taagaaattgatctattctttggaccaagtagagtgttctctgcagtatttaaaaatgct
ctattaaaaagtgtcactcagtatcataaattcaaggaagaaaacaaagatgataacttg
aactttgacagaaaagtatttagaatggaaaaagagccaatattttaagctatattgcag
aatatggtacttggattggctgtgaacttgaagaagaaggccagaattagaataaagaac
tcttgtgtactaattggtgtcattgatgaaactggctcactcaatgatggggaaatcttt
gtgaaaataaatagaagcagttatgatttagataatgcttaggacattattagcgaggaa
cttgataagaattatgacaatatgacaaaaaacacaaatgcctaggtcattttcacttac
gaagattaacagatttcaggaaaagttattgtaactaagaatccctgcagtcatcctgga
gatataaggttactgactgccattggaccagaagatgagagatgctaagtatttgaggaa
ttgataaatgttattgtatttccaagcaaaggatatagaccagagtagcacaaaatgtca
ggcggtgatttggatggagatgtttacatgtgcatctgggatgatcaaattgtctcgcaa
atccctgagagttgctgtaaaactggttaatgcactcgccaggaaggtatccagcctcct
gcagtatacaagaaatttgaagaagacagcaatgtaaatagtgataatattgtagatcac
atggctaattacttcgagagagacaaccttggtcatttggctcacttacatctcggttta
tgcgactaggaaggtgtaaaagggcctttccgacaagagatgattgaactctcttggtat
atgtctatagcagtagactttgccaagcatggtaaatcagttgaaccacataagtatcag
catatcgaaagaaaattgaactaatggcctgatttcatggagaagcatgactagtttaga
aagactgttcaatcaccattggtccttgggaagctatatagagcagttaattgtaagagc
ttttatcgcaagttgatggagtatgactatgaaatgtctatcttgctgaaatatgagttg
aatgagactattattaagaaaagagaagaagattaaaaaacatactcaagagatttcatc
aattacctcataccagcatttgatagaatagtagtacctttaaaggaaaagctaagagat
ctaatggtaatgtacaatattgctcacgaatctgagcttttttgtacaaatctcactttc
tctcttaatgatgaaaatatggataagatagttggagacccaggccaaaaagatgaagat
gctgtaagagctctaaatcatagattgcaagagtatctcacctaatacaagaatgaattc
caaaaatgtatcaaagaccttgaatgtgttccaggtatatttgctaaagctgtgtattat
gctacctattataatgaagacaatatcccatatcaatagttctccactgcatagatctgg
gctaaatctgataaaactacttagaacttaaaagatttgttgattagatttgaggagcac
tggaaagctcatattagttaagaaatgagctcaagacacttaaaaatgcaagaagcaata
aaagactttagccactacaagaaggttttagaaaaagacacaaaatcctcaaaagataag
ttgaggctgcttttggaagttagataattctttagcatcccatggataatttgtcatgaa
tatcttatagattga