Identifiers and Description

Gene Model Identifier

Contig9504.g10170

Standard Name

RNA31 (RNase III domain protein)

Aliases

None

Description

RNase III domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IEA) | GO:0005749

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9504.g10170(protein)
MTPFDNERYQSLQSICYHVSELNDAKIIRQFIKSFLRGKIIINNLEESKEQRLSLRQTIR
VREENHIEEFKTFEDYLLWNPQAIGEALTSSTIRKQYNNERFEFYGDTVLNYLVVLEFFL
CADQNWTEKDLDYWRIKIVENKNLAQINFRQQLYQYLIMDKNKIFNDVVPADFEHIDYHQ
NLKQKYLNEFQTKITQIRRQRFIINNATESEIEINELNIEYVELLKSILTKQNAFQLIKS
KQAQLIVTEEKQKLFKNRAVTQEAGIEQAHEFIKNKLNILGFSLSEYAENRNKLMSEFGK
IPIDANEIAQIFKLEKILNYEFSCKQIAIVALTHNSITESKNQKESQSNNPENDQLIQSK
KLQNYERLEYLGDEILGLLVTQYIVGVTKDQKQNQNPEKMHKLRAQIINNTMLSLITIET
NIYEFIRFDEQQETYRQQIDNFVQQVKENLKRQGSSKQNAIKFIGLNAYNCRKTYETALT
LNYLKDDDTDLKKEFIQNIEKNDHEITLEQTYDLLLKHDVFPIDIEQLQESNIKIFGDVF
ESLITAVFLDSGSLDITQRVLFKILEPYLIIYANIDRQKDNKRAQLQDLWNKTKYFKELK
FEMTQENTKDYIIYSGWIMTTEVMKLKFDAIVKSKVRKFYSKFYQFVQESIEQFEKIAED
LTYFNYLIFVKKFRVQWAQNQTSDS


>Contig9504.g10170(coding)
atgactccttttgataacgaaagatattaatctctctaaagtatatgctatcatgtatca
gaactaaatgatgctaaaatcattagataatttataaagtctttcttaagaggtaaaata
attatcaataatttggaggaaagtaaagaataacgactaagtttaaggtagactattaga
gtaagagaagaaaatcacattgaagaatttaagacttttgaagattatttactttggaat
ccttaggctattggagaagcattaacatcatcgaccataagaaaatagtataataatgaa
agatttgagttctacggagatactgtattaaattacttggttgtgctagaatttttctta
tgtgctgattaaaactggactgagaaggatttagattattggagaataaaaattgtagaa
aacaaaaatctagcatagataaattttagataataactgtattaatacctaattatggat
aagaataagatatttaatgatgttgttccagctgatttcgaacatattgattatcattaa
aatttaaaacaaaaatacctcaatgagtttcaaactaagataactcaaatcagaaggtag
aggtttatcataaataatgctactgaaagcgaaatcgaaataaatgagttaaacattgaa
tatgtggaattgctaaagagcattttaactaaataaaatgctttctaattaataaaaagc
aaataggcccaattaatagtgactgaggaaaaataaaaactatttaaaaatagagcagta
actcaagaggccggaatagaataagctcatgaatttataaagaataaactcaatatactt
ggcttctccttgagtgagtatgcagaaaatagaaataagctgatgagtgaattcggcaag
attccaatagatgccaatgaaatagctcaaattttcaagttagaaaagatattaaattac
gaattctcgtgtaaataaatcgcaattgtagctcttactcacaattctattaccgaaagc
aaaaattaaaaagaaagtcaatctaataatccagagaatgactaactgattcaatctaaa
aaattatagaattatgaacgacttgaatatctaggtgatgagatactaggattactagtt
acacagtacatagtgggagtgactaaggactaaaaataaaattaaaatccagaaaaaatg
cacaagttaagagcttaaataatcaacaacactatgctaagtcttattactattgagaca
aatatttatgagttcattcgatttgatgagcaataagaaacatatagataacaaattgat
aatttcgttcaacaagtaaaagagaatctcaagagacagggttcatcaaaataaaatgca
atcaaatttattggtcttaacgcatacaattgcagaaaaacttatgagactgctctcacc
ttaaattatcttaaggatgatgatacggatttaaagaaagaattcattcaaaatattgaa
aagaatgatcatgaaattactctggaatagacttatgatttactattaaaacatgatgtt
tttccaatcgatattgaataattgcaagagagtaatataaaaatatttggagatgttttt
gagagcttgataacagctgtttttctggattcaggcagtttagacataacataaagagtt
ctgtttaaaattcttgagccttacttgatcatttatgccaatattgatcgatagaaagac
aataagagagcttagctccaagacctatggaacaaaacaaaatatttcaaagagttgaag
tttgaaatgacataagaaaatacaaaggactacataatttactctggatggataatgacg
acagaagtgatgaaattgaaatttgatgctattgttaaaagtaaagtccgcaaattctac
tcaaaattttactaatttgtttaagaaagcatagaataattcgaaaaaattgctgaagat
ctaacttacttcaactatttgatatttgtaaagaaatttagagtgcaatgggcttaaaat
taaactagtgattcatga