Identifiers and Description

Gene Model Identifier

Contig14283.g15211

Standard Name

RNA32 (RNase III domain protein)

Aliases

None

Description

RNase III domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • ruffle membrane (IEA) | GO:0032587
  • mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IEA) | GO:0005749

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14283.g15211(protein)
MESVIGAVTQEAGLEQAHEFLKNKFNILGYSLSEYAENRNKLMSEFDKISIDANEITQIF
KLEEILNYEFKYKQIAIVALTHKSLTENKNQKDNQSINPDNDQLIETKQIQNYERLEYLG
DEILGLLVTQYFVGVTKDQNQNQNPEKLHKLRSQIVNNTMLSLITIETNIYEFIRFDELQ
ETYRSQIDNFVQLVKENLKRKGSSKQNAIKFIGLNAYNCRKTYESALTLNYHKDEDTDLK
KLIQNIKQNDHEITLEQTYDLLVKNEVFPIDIEQLHESNMKIFGDIFESLIAAVFLDSGS
LEITQRVLFKILEPYLIIYANIDRQKDNKRAQLQDLWNKTKYFKQLKFEMTQENTKDYII
YSGWIMTTEVMKLKFDAIVKSKVRKFYSKFYQFVQESIEQFEKIAEDLTYFNYLIFVKKF
RVQWAQNQTSDS


>Contig14283.g15211(coding)
atggaatctgttattggagcagtaactcaagaggccggactagaataagctcacgaattt
ctaaagaataaattcaatatacttggttactccttgagtgagtatgcagaaaatagaaat
aagctgatgagcgaattcgacaagatctcaatagacgctaatgaaataacccaaatcttt
aagctagaagagatattaaattacgaattcaagtacaaataaatagcgattgtagctctc
actcacaaatctttgaccgaaaacaaaaattaaaaagataatcaatctattaatccagat
aatgactaactgattgaaactaaataaatatagaactatgaacggcttgagtatctcggt
gatgagatattaggattactagttacacagtactttgtgggagtgactaaagactaaaac
taaaattagaatccagaaaaattgcacaaattaagatcataaattgtcaacaacactatg
ctaagtcttattactattgagacaaatatttatgagttcattcgatttgatgagctataa
gaaacatatagatcacagattgataatttcgttcaactagtaaaagaaaatctcaagaga
aagggttcatcaaaataaaatgcaatcaaatttattggacttaacgcatacaattgcaga
aaaacttatgagtcggctctcaccttaaattatcataaggatgaagatactgatctaaag
aaattgattcaaaatattaaatagaatgatcatgaaattactttggaataaacttatgat
ttactagtaaaaaatgaagtttttccaatcgatattgaataattgcatgagagtaatatg
aaaatatttggagatatttttgagagcttgatagcagctgtttttcttgattcaggcagt
ttagaaataacataaagagttctgtttaaaattcttgaaccttacttgatcatttatgcc
aatattgatcggtagaaagacaataagagagcttagctccaagacctatggaacaaaaca
aaatacttcaagcagttaaagtttgaaatgacataagaaaatacaaaggactacataatt
tactctggatggataatgacgacagaagtgatgaaattgaaatttgatgctattgttaaa
agtaaagtccgcaaattctactcaaaattttactaatttgtttaagaaagcatagaataa
ttcgaaaaaattgctgaagatctaacttacttcaactatttgatatttgtaaagaaattt
agagtgcaatgggcttaaaattaaactagtgattcatga