Identifiers and Description

Gene Model Identifier

Contig12083.g12926

Standard Name

SET1 (SET-domain containing protein)

Aliases

None

Description

set domain containing protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12083.g12926(protein)
MNIDNNIYKRPTARVQGMSSRQQVLYLLQKTQKEANWDMENDSDFQDELSQETYQNTNDE
LQQPSKRRVLDSYSVPYNEELEIKREKMRQQEIKNHPERFRLLAYSLSQFTPIKKNKYLE
RKRHILLEKEANQLLVCNCQRSTIKKNEKTNPLQSFNCGERCINRCVSTECCVQTCPSGA
FCKNRRFQLHQNAYVFPAKTEKKGWGLFAGEFIPKGTFIMQYVGEVFSVDSDLGQERVQQ
YRNSTCTYLMRTTNNEVIDPTYVGNIARFINHSCEPSCETQKWNVLGEVCVGIFALRDIQ
ENEELSFDYQFDFFKTPFTKCYCGTSKCKGYLGVLSRNNEDDDEELENPLCVYCQDYIND
KDDLVVCNGNCRETYHIICIIKKEGKTKTQAQALMQQSDRRNFLCRDCLTSLNIKKRKNK
KLNREGEDSSQWQNDSNTLENPQEDKDDDNHDDNVLPWESKDPNVRKYYEDSKKNREIDK
IIMREIDLIIQNMAEINELANQNSKMKRAKKKNSQFSDFYNFISELQKRLKMRSSGDKEH
IKFRKHKDDIQESKRNKLQLLQSKKNLKLSKIDLEEVKKKRGRPRKIQSSQSFASHKEYI
QPKLQQSQSAQFSKNDQIQSFSRKIMTIENDFLRSQSKKYIDQLSETENIRKINSMLSPS
QLLIGDNKIEVDQTHDSFVSHEKEQDFQEDEGMEQDFDDEGEDDDQQDLDQIDEEEDDDD
YFDEEDNDDNEDLDLSNVNNVELNLEKLQGLNEEEEEEKLQVRSGQDAHTGGSSKSFQTA
NNVINSQNFGKQSSIQSSLTNESILIKRLRQLSGEHDLLIGSDYLIKRTPIKQGLIFNQS
PSKHSILQTGQSSNEIGYHREKFLVQNFIRIRIDEFLKEQLKNESNLTPSELIVRESKLN
IYETVFNIVINDNIDTLQCIPTKFQIFWEQSWGGMVTVRLQSTLKQYIFITNLMQEVTDM
LFKSNLLTQNSSTGYFIGQKLDLVSNKDVKSQFPFDIVLLKVPKNFIRKLVGYQEKTLTE
YRKIFAVDFYFDRELLTDDVFHMHENTELRIFGKNQDVYAVNELVQKELEQIKMKTILLQ
MNDCKLLMDNVKEVKVLVDPCEIRVKRMMREWKDLRHPFYYLPNYFREMALIGKIQEIRD
AELRIEQFFLSKRDMNYVNNQQISFLLPIYFKSISNEIKNQVSLRCPSIQLFFYEPTYPR
KHLTVLMIGPWQALMQAKIILEEQANVYMFRNNHSFENFQQFTYHQQIRFSFKSLKRFVL
EKDIKYLNHWDLCSIFLEDAGKEPVFEDLKKQLMSSQAEIQSYIMNPLLINQPQLQILSA
SQSFPVYPFSAQNQLFQQQQLMIQAQIEQKRQLIIMEKMKDYKALVDFLKNQDVETCINS
LFVLHDYENAEESLSKLMNRLKVNKNELIQFMNVMLTRNVEDYEDSIRNFSSRYEQVRVI
DQSQNDEEKLVIQQNRDSMKRYKNTYGDTQSYNRSRSHSYRQELNYHGRNDRDEGSYDRG
YSNKNNQRIQPFNPDNYQNAQPRTEQKESRSSYYSRSKSKSRRRKQSYTSDRSSSDRGTN
YRSSKYNRDHHSESPDNHRRYHDARISQNRHNRKRSDSRDYNRSYKDSTYNRSGYSQRGR
DRDDSSHHYRKRDYEDSHQYNSNYHHRDRGRSSGSERSSNEYDNYNYRNSSHHNNRERER
SRHGDYSSSRYNDQYQHQTHGPSSSHRYHDYNSSNHYNSYTKKYDDYSSYNRSSRHNYSS
RRRSRSYRSASSERRYRSPSHYHRYRRRSRSYYGGHYRRSRSRYERHHRHHHHHYHKDPY
HHVRALQNANRVKHKGGFDYGQMSSNFGVPIQNQAYGNDQSFANHQSNASQQNQNQTYSN
MMRQQNQYASGFGNYSSNYRNSNSNLNEEGQL


>Contig12083.g12926(coding)
atgaacattgacaataatatatacaaaagacctactgccagggttcaaggaatgtcctcc
agacagcaagttctttatttattgcaaaaaacgcagaaggaagccaactgggacatggaa
aatgactctgatttccaagatgaattatcccaagaaacctaccaaaataccaatgacgag
ctatagtagcccagtaagagaagagttttagacagttattcagtgccatataatgaagaa
ttggaaattaaaagagagaaaatgaggcaacaagagataaagaatcaccctgagcgtttc
cgcttacttgcttattctctgtcccagttcacgccaatcaagaaaaacaaatatctagag
agaaagcggcatattctactcgagaaagaagcaaactagctattggtttgtaattgccaa
agatcaactataaaaaagaatgaaaaaactaatccattacaatcatttaactgtggtgag
aggtgtatcaatagatgtgtatctactgagtgctgcgtatagacgtgtcctagcggggca
ttttgcaagaacagaagatttcaattacactaaaatgcttacgtgttcccggccaaaacc
gagaaaaaaggctggggattatttgctggtgagtttatacctaagggaacttttataatg
cagtacgttggtgaagtattctctgtggattctgaccttggataagagagagtttagtaa
tatagaaactctacttgcacatatcttatgcggactacaaacaacgaagtaatagatccc
acttacgttggtaatattgcgaggtttattaatcactcttgcgaaccaagctgtgaaact
caaaaatggaatgtgttaggtgaggtttgtgttggcatattcgctttaagagatatataa
gaaaatgaagaactatcatttgattactaattcgatttcttcaagactccctttaccaaa
tgttattgtggcacttcaaaatgcaaaggttatctaggagtactctcaaggaataacgag
gatgatgatgaagaattagagaatcctctgtgtgtttattgccaggattatatcaatgat
aaagatgatttagtagtctgtaatggaaattgcagagaaacttatcacattatctgcatc
attaagaaagaaggcaagaccaaaacttaggctcaagctctcatgtagcaatctgataga
agaaactttttatgtcgagattgtctaacatctttgaatataaagaaaaggaaaaataaa
aaattgaatagagagggagaggattcatcataatggtaaaatgacagtaatactcttgaa
aacccctaagaagataaagatgacgataatcatgatgataatgtgctaccttgggaatct
aaagatccaaatgtgagaaaatattatgaagatagcaaaaaaaacagggaaatagacaag
attataatgagagagatcgatctaatcatccagaatatggcagaaatcaatgagttagct
aattaaaatagtaaaatgaagagagcgaagaagaaaaatagtcaatttagtgatttttac
aactttatatctgaactttagaagagattgaagatgagatctagtggagataaagagcat
attaaatttagaaagcacaaggatgatatataagagagcaaaaggaacaaactttagctt
ctatagtctaagaaaaatcttaaattaagtaagattgatctagaagaagtgaagaaaaaa
agaggtaggccgagaaaaatctaatcatcttaatcatttgcaagtcataaggagtacatt
caacccaagctctagcaatcatagagtgcacagttcagcaaaaatgactagatataaagc
ttttcaaggaaaattatgactatagagaacgacttcctaagaagtcaatcaaagaagtat
atagattagctttctgagactgaaaatattaggaaaattaattctatgttaagtccatct
tagcttttgattggtgataacaagatagaagttgattaaactcatgattcatttgtcagt
catgaaaaggaataggacttttaagaggatgagggtatggaataggactttgatgatgaa
ggtgaggatgacgattagcaagatttagattagattgacgaagaggaagatgatgatgat
tattttgatgaggaggataatgatgataatgaggatttagatttatctaacgttaataat
gttgaattaaatcttgaaaaacttcagggcctcaacgaagaggaggaagaagagaaatta
caagtgagatcaggccaagatgctcacactggaggtagttccaagtccttccaaacagct
aataatgtaattaattcctaaaatttcggaaaacaatcaagtattcaaagctccctaacc
aacgaatcaattttgattaaaagactgagatagctctctggcgagcatgatctattgatt
gggagtgattacttaattaaaagaactcctataaagcagggacttattttcaattagagt
ccaagcaagcattctattctctaaactgggtagtcaagtaatgaaataggttatcataga
gaaaagtttttagtataaaactttattcgaataagaattgatgaatttctgaaggaatag
ctgaaaaatgaatcaaatcttaccccttcagaacttattgttagagaatcaaaactcaat
atctacgagactgttttcaacatagtcattaatgataacatcgatacattatagtgcatt
ccaactaagttctaaatattttgggaacagtcatggggtggaatggtcactgtaagattg
caaagtactttaaagtagtatattttcatcactaatctgatgcaagaagtcactgacatg
ctatttaaaagcaacttgctgacctaaaatagctcaactggctactttattggtcagaaa
ttagatctggtctcaaataaagatgtaaagtctcaatttccgtttgatatagtgctgctt
aaagttcctaagaacttcatcagaaagttagtgggctattaagaaaagactttgacagag
tatagaaagatatttgcagtcgatttctactttgacagagagctactgactgatgacgta
ttccatatgcatgagaatacagagcttagaatattcggtaaaaatcaagatgtctacgct
gttaatgaactagtgcaaaaagaacttgagcaaatcaaaatgaagactattttgcttcaa
atgaatgattgcaagttgctgatggataatgtaaaggaagttaaagttttggttgatcca
tgcgaaatcagagtcaagcgaatgatgagagaatggaaagatcttaggcatccattttac
tatctgccaaactacttcagagaaatggctcttattggtaaaattcaggaaattagagac
gccgagttaagaattgagcaatttttcttgtcaaaaagagacatgaactatgtgaataac
caatagattagctttctgcttcctatctacttcaaaagtatcagcaatgagattaaaaat
caagtgagtttgagatgcccctccatccaattattcttctatgaaccaacatatcccagg
aaacatctgacagtattgatgataggcccttggtaagccttaatgcaggcgaaaattata
cttgaagagtaggcaaatgtttatatgttcagaaataatcatagtttcgaaaattttcaa
tagtttacctaccattagcagattagattctcgtttaagagtctaaaaagatttgtttta
gagaaggatataaagtatctaaatcattgggatctatgctctatattcttagaggatgca
ggtaaagaacccgtatttgaagacttaaagaaataattaatgagcagccaagcagaaatt
caatcctatattatgaatccattattgataaatcagccttagcttcaaatactttcagct
tcttaatcattcccagtttatccattctccgcatagaatcagctattctagcaacaatag
ctaatgatctaggcctaaattgagcaaaaaaggcagttaattattatggagaagatgaag
gattataaggctttagttgatttcttgaaaaactaagatgttgagacttgcattaatagc
ttattcgttcttcacgattacgaaaatgctgaagaatccttaagtaaactcatgaacaga
ctcaaagttaataagaacgagcttattcagtttatgaatgttatgcttactagaaatgtt
gaagactatgaggatagcattagaaatttcagtagtcggtatgagtaagtgagagtcatt
gatcaaagtcaaaacgatgaggaaaaactcgtcatttagcaaaacagagattcaatgaaa
agatacaaaaatacctatggtgatacgtagtcatataatcgaagtagatcccattcttac
agataagaattaaattatcatggaaggaatgacagagatgaaggaagttatgacagagga
tatagcaataagaataattagagaatctaaccatttaacccagacaattatcaaaatgct
tagccaagaactgaatagaaagaatcaagaagcagctactatagcagaagcaaaagtaaa
agtaggagaagaaagtaatcctacactagcgataggagttcaagtgatagaggaactaac
tatagatcctcgaagtataatagagatcatcatagtgagagtccggataatcacagacga
tatcacgatgctagaatatcttaaaataggcataatcgcaaaagatcagattcaagagac
tacaacaggtcttataaggattcaacttataatagaagtgggtattcttaaagaggaaga
gacagagacgattcatctcatcactatagaaagagagattatgaagatagccattaatat
aactccaattatcatcatagagatagaggaagaagtagtggtagtgagagatccagcaat
gaatatgataattacaactatcgcaatagtagtcatcacaataacagagaaagagaaaga
tcaaggcatggtgactacagttcatcgcgatacaatgatcaatattagcattaaactcat
ggtcctagcagctctcaccgttatcatgattacaactccagtaatcattataatagctat
acaaagaaatacgatgactacagcagttataaccgatcaagcagacacaattacagttcg
agaaggagatcaagatcttatagaagtgcttcaagtgaaaggagatataggagtccaagt
cattatcacaggtacagaagaagatcaagatcatattatggaggacactacagaaggtca
aggtcaagatatgaaaggcaccatcgccatcatcatcaccattatcataaagatccatat
caccatgtcagagccctctagaacgctaacagagtgaagcacaagggaggcttcgactat
ggttaaatgtccagtaactttggcgtgccaattcagaatcaagcctatggaaatgattag
agctttgctaatcatcagagtaatgcaagctagcaaaatcaaaactaaacttacagcaat
atgatgagacaatagaatcagtatgctagtgggtttggaaactacagcagcaactatcgc
aacagcaacagcaacttgaatgaggagggtcaactatga