Identifiers and Description

Gene Model Identifier

Contig7302.g7802

Standard Name

SIRT5 (Sirtuin 5, NAD-dependent deacetylase)

Aliases

None

Description

Sirtuin 5, NAD-dependent deacetylase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7302.g7802(protein)
MAGAGFGVDSGLPDFRGPNGFYKAYPYFEKVGMNFQDAANPQFFKKDPKRFWYFYGHRHM
LYANTEPNQGYMILNEWAKNDFGPDHHFVFTSNVDHQFQKAGISDKNIYECHGSIFVFQC
DKCNIVEERLDEKFELDENTYETESIPECQKCQSFMRPNCLMFGDFDFNEQVSEQQDQRY
KAWLENIKDQSLLIIEIGAGSAVPTVRLNSEDVLTVLRNKNTNMIRINPAEQNVYRATKK
WINIIDKNIANEMVDSDIQNLNLEMRYLVQVEAGGKDTLVAIDNIIKKQI


>Contig7302.g7802(coding)
atggcaggagcaggttttggggttgattctggactaccagattttagagggcctaatggg
ttttataaggcatacccatattttgaaaaagttggaatgaatttctaagatgcagcaaat
ccttaatttttcaagaaagatccaaaaagattttggtatttctatggccatagacacatg
ctatatgcaaatacagaaccaaatcaaggttatatgatcctaaatgaatgggctaagaat
gattttggacctgatcatcacttcgtatttacaagtaatgttgatcattaattctaaaag
gctggaatttctgataaaaatatttatgagtgtcatggaagcatttttgtctttcaatgt
gataaatgtaatatagtagaggagagactagatgaaaagtttgaactagatgaaaatact
tatgagactgaatcgatacctgaatgtcagaagtgtcaatcgtttatgagacccaactgt
ttgatgtttggagattttgatttcaatgaataagtttctgaataataagattagcggtat
aaagcatggctagaaaacatcaaagatcaatcactgttgataatagaaataggtgcaggt
tcagcagtaccaacagtaaggttgaatagtgaagacgtattaaccgtcctacgaaataaa
aataccaatatgattagaatcaatccagcggagtaaaacgtttatagagcgacaaaaaaa
tggataaacatcatcgataaaaatatagccaatgaaatggtagattctgatatttaaaac
ttgaacttagaaatgagatatttagtataagtagaagctggtggtaaagacactttagta
gctattgacaatataattaaaaagtaaatttga