Identifiers and Description

Gene Model Identifier

Contig3782.g4052

Standard Name

SNF21 (ATP-dependent DNA helicase)

Aliases

None

Description

ATP-dependent DNA helicase

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3782.g4052(protein)
MLYLILNSDETFELRWVDYYSISGFDEIMNLEAGTYPPSTSVSNTNTSDKNNEKNAADNK
KEEEARLTVQEQDKIVEDKIQEIIEKRNVNVCMYGRHDLTGDKDLKFSVTHCYHNGNDDL
FDTEELKKEFSGETFENMKTMYMNLKRVQNLKNQGKQNSAEFQEIFENMQIAFEKVKQLE
LEEQNEAAIEQQNNFNNHKSNRLITADQLQLRREQIHNQTQKVYRERFEENLQVNYKDLC
DYINKKLQNEGENSLRLGNTGNNNHSEYLQQYLQHINESDEINQQMELLQKVIDDKDTPA
DIKKKSQFQLKLLKLKPLQQKMREDILSRYSLNKIALQNYKQQTQGDYLFERQLVDRDFY
KRAKVYSSSKKEARTLDRFEQQMRSGQELRKKTRHKELLNEIIFHANKFTEFHKKRQNQI
RKKALIIKTNLDSKEKKEQMARDKEERDRIKLLKDNDFEGYINLINTQKNSRLLQILEQT
HKYLEQLGAKVSIQKQESQLNKKKKTVGGGQPNANENEAEKEIKYDEYGNVIEECNEDEI
PDSEKIKSNLKNSSKIYYAITHTVQEEIKDQPKMIKGGVLKSYQMIGLNWLVSLYNNNLN
GILADEMGLGKTIQTISLFSYLIEVKGNEGPFLVVVPLTTISNWIMEFEKWSPDIRKIVY
KGKKHERPLLAQHLKNDKFHVVLTTYEYVLNDKSTLCKVPWQYIIVDEGHRMKNQKSKFA
LTLGQQYQSAHRILLTGTPLQNNLSELWALLNFLLPKIFSSCEEFQKWFDKPLSKIHPLT
NSKFNPNEKQAFELSEEEQLLIINRLHQVLRPFLLRRVKSEVEKELPNKIEMVIKVDLSA
WQRIVYDGITDNGKLARDPSTGKIGNLALRNTVMQLRKICNHPYLFLDGFEPDDLRENIY
RSSGKFELLDRILPKLISTGHKILIFSQFTQLMDIMQIFFDFKGIKHLRLDGGTKHEDRS
KNLAIFSSDQSEFQVFLLSTRAGGHGLNLQVADTVIIFDSDWNPQMDEQAKDRAHRIGQK
REVRVYRLITTTKIEEGILSKATQKKDLDAKIIQAGMFNDKASDVDRQKRLEDLIRKDYE
DDGDGNVDETETPNDDQINDMIARDQNEYDIFTRLDQERYKDERKEERLQEIKKRYDLEG
RLININNVNYRLLQDWEVPEWIKIKPDDPNKLIEEFGMGKRQRKQVNYNDEISEGQWLKI
IESGADINQEVEKIKKRRMDQRDRPSNQAEIAQADLAKRRKLNDNSESLLSGDEDDEIYA
MDNNVHNVSIKKQGYTSETSQVSDRVKIIGVNNNSNGIKIQIKKDSNEDSKGAHSNSSRS
NKKVDHHSKSKKSSSKKPQNHKIQKEEEFNDEDDLVMSDNELEEGEIPEPIVSHSNGGRE
KRKAAPTNLKEK


>Contig3782.g4052(coding)
atgctttacctaatcttgaattctgatgaaacattcgagcttagatgggttgattattac
tcgataagtggctttgatgaaattatgaatcttgaagcgggaacataccctccatcaacg
tctgtatcgaatactaatacttctgataaaaacaatgaaaaaaatgcagcagataataaa
aaagaggaagaagcgagattaactgtttaggaataggataaaattgtagaagataagatc
taggagatcattgaaaagagaaatgttaacgtatgtatgtatggcagacatgacctaaca
ggcgacaaagatttgaaattttctgtgacacattgctatcacaatggaaatgatgactta
ttcgatactgaggagttgaaaaaagaattctcaggggaaacatttgaaaatatgaagact
atgtacatgaatctcaagagagtccaaaatttgaagaatcagggtaaataaaactctgct
gagttccaggagatctttgaaaacatgcaaatagcattcgagaaagtaaagcaacttgag
cttgaagaatagaacgaagcagctattgaataacagaataatttcaacaatcataagtca
aacagactgatcactgctgatcagctacaattgagaagagagcagattcacaattaaact
caaaaagtttatagagagagatttgaggaaaatttataagtcaactacaaggatctttgc
gattacataaacaaaaaactacaaaatgaaggtgaaaattcattaagacttggtaacact
ggcaataataatcactcagagtacttgtaacaatatctctagcatatcaatgaaagtgat
gaaattaaccagtaaatggagctactccaaaaagtaatagatgataaagatacacctgca
gacataaagaaaaagtcctaattctaacttaaactattaaaactcaagcctctacagtag
aaaatgagagaagatattttgagtaggtatagtctaaataaaatagctcttcaaaactac
aaacaacaaacttaaggtgactatctatttgaaagataattggttgatagagatttttat
aaaagagcaaaggtgtactcaagtagtaagaaagaagctagaacacttgacagatttgag
cagtagatgagatctggataggaactcagaaagaagactagacacaaggaattattgaat
gaaatcatattccatgccaataagtttactgaatttcacaaaaaaagacaaaattaaata
aggaaaaaggctttaatcattaagactaatttggattctaaggaaaagaaagagtaaatg
gccagagacaaagaggagagagatagaattaagctcttgaaggataatgattttgaaggt
tatattaacctcattaacacgtagaagaattctagattactacagattctggaacaaaca
cataaataccttgagtaacttggagctaaggttagcatccaaaaataagaaagctagttg
aacaaaaagaaaaagacagttggtggaggataaccgaatgcgaatgaaaacgaagctgaa
aaagaaatcaaatatgatgaatatggaaatgttatagaggaatgtaatgaagatgagatt
ccagatagcgagaaaataaagagtaatttgaagaatagtagcaaaatttattatgccatt
acccacacagtctaagaagaaataaaagactagccgaaaatgatcaaagggggagttctt
aagtcgtattaaatgatcggcctaaactggctcgtcagtctttataacaataacctcaat
ggtatattagcagacgagatgggtcttggtaagacaatctaaactatttcactcttcagt
tacttaattgaagtaaaaggaaatgaaggccctttcttagtagttgttccgttaactaca
atttcaaattggattatggagtttgagaagtggtcgcccgatattagaaagatagtatac
aaaggaaagaaacatgaaagaccattgctagcgtaacatttaaagaatgataagtttcat
gtcgttttgacaacttatgaatatgtgttaaatgataaatctactctctgcaaagtacct
tggcaatatattattgttgatgagggtcacagaatgaaaaattaaaagtctaaatttgct
cttactcttggtcaataatatcaatctgctcatagaattttactaactggaacaccactt
caaaataatctgagtgagctttgggctcttttaaactttttgctgcctaaaatcttttca
tcttgtgaagaattttagaaatggtttgataagcctttaagcaaaattcatcccctgaca
aattctaaattcaaccctaatgaaaaataagcctttgagttgtctgaagaagagtaacta
cttatcataaacagattgcatcaagtattgaggccattcttgctgagaagagtcaaatct
gaggtggaaaaagaattgccaaataagattgaaatggtcattaaggttgacctctctgca
tggtaaagaattgtctatgatggaatcacggataatggaaaactagcaagagacccttca
acaggtaaaattggaaatcttgccttgagaaatactgtgatgcagttaagaaagatttgc
aatcatccttatctcttcttagacggctttgaaccagatgatttaagagagaatatctac
agaagtagtggaaagtttgaattacttgatagaattctcccaaaactaatttctactggg
cataaaattttaatcttctctcaatttactcaactcatggatattatgcaaatatttttt
gacttcaaaggtattaagcatctcagacttgatggtggaactaagcacgaagatagatct
aaaaaccttgctatatttagttctgatcaatctgagttctaagtatttttacttagtact
agagctggaggacatggtctcaatttgcaagttgctgatactgtgatcatatttgattca
gattggaatccataaatggatgaataagccaaggacagagctcacagaattggctaaaag
agagaggtaagagtctataggctcattacaacaactaaaattgaagaaggtatattgtct
aaagcaacttaaaagaaagatctcgatgcaaagatcatttaagcaggtatgttcaatgac
aaagcaagtgatgtcgatagatagaaaagacttgaggatcttattagaaaagattatgaa
gatgatggggatggaaatgttgatgagactgaaactcccaacgatgattagataaatgac
atgattgctagagattagaatgaatacgatatctttacaagattggactaggaaagatat
aaggatgagagaaaagaagaaagactctaagaaatcaagaaaagatacgatcttgaagga
agacttattaacattaataatgttaattacagactactttaggattgggaagttcctgaa
tggatcaaaatcaagccagatgatcctaacaaattgattgaggaatttggaatgggcaaa
aggcaaagaaaataagttaattataacgacgagattagtgaaggataatggttaaagatt
attgaatcgggggctgatatcaaccaagaagtggagaaaatcaagaaaagaagaatggat
taaagagatagaccttcaaactaagccgaaattgcttaagctgacttagctaagagaaga
aaactgaatgacaactccgaaagtttattaagtggagatgaagatgatgaaatttatgca
atggataataatgtacataatgtttctatcaagaagcaaggatatacctctgaaacctca
caagtatcagatagagtcaaaataattggagttaacaacaactcaaacggaattaagatt
cagattaagaaggatagcaatgaggatagtaagggtgctcacagtaatagttcaagatca
aacaagaaggtagatcatcatagcaaatctaagaagtcttcttcaaagaaaccacaaaat
cacaaaatttaaaaggaggaagagttcaatgatgaagacgatttagttatgagtgataat
gagttagaagagggagaaattcctgagccaatcgtcagtcattctaatggaggcagagaa
aaaagaaaagctgcgcctacaaacctcaaggaaaaatga