Identifiers and Description

Gene Model Identifier

Contig16852.g17954

Standard Name

SNF23 (putative hromatin-remodelling complex ATPase iswi2; SMARCA1)

Aliases

None

Description

putative hromatin-remodelling complex ATPase iswi2; SMARCA1

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16852.g17954(protein)
MSTSKDRLEELLLKAENYARIIFQKQSKPAGKQKQQGKDEGKSSKRKSKQKISKEIDDQN
EELEAGNSIKLLEQPSMLKNGKLQPHQLDSLNWMITLYDLGLNGILADDMGLGKTIQAIT
MLVYLYQYKKIKGPHLIITPKSTISNWMKEFNHWAPFMRVVNLNPMMEFRNEIIQNQMQK
DQFDVCVTTYEAVNICNSDLRKINWHYQIYDEAHKLKNSEGVVSINSRKLSCRNRLLMTG
TPLQNNIQELWSLLNYLMPEIFSSSDDFCDWFNLDSQKKTEAKMDLESIQKLHKIMRPFL
LRRTKKDLETQLPDKIEMNVKIPLTSMQLDLYEQLLKTTTIFNSKNTSTKTYYNLLMQLR
KVCNHPYLFENVEPEGAEEYGEHIIENSGKMRFLDKLLKKVSQQKDQALVFSLFTSVLDI
IEDFCILRGYKYCRLDGSTDLDTRETLIKEFVEPGSDVVVFLLSTKAGGLGLNLMTANHV
VLYDSDWNPQVDLQAMDRAHRIGQKKKVYVYRLICSSTCEEKIIERQAIKLKLDQVIIQQ
GKAAAISNNLNKDEYEKILLHGAAMILQQKQQAHQQEEIDIELLIQDGEQRALQMKEDAT
QQAEKMKNCFDFSYNEIDYFSFQNQDYRNEKVKFQQLQMEEQQKKMQAMMEENKDGPTLG
RTRRFVHMRDMTMIDTTIDYTEKQKKNKDKDFTQKVKKQSIGMMSKVHDFQFYDNIEELK
EYMEIIKSKVDNYENVTNEELEVLKNMLNTGFHSWTLREYQKFIKAIRKYSIKDVQAIAQ
MIETKTVEEVQEYMNVFMLRFRELKEKDIVISQLQKSDLDQKILETIRDFDINKDYVLFM
QENNYFNRNTYLAMIENAHNKMMIQNNKIKPQDLQLKIDHFFHSQTKQMVQEQLKYITIA
IRAEDCLRGHMAFGNERKKMRDLIDKSKKFSQGFQEGISAKEKDLRKKDAQQEIKQESRQ
IKRVGAIDDNLKFGRRKRTAALFQTARDPSSQKMDTN


>Contig16852.g17954(coding)
atgtctacttcaaaagatcgattggaggaactattactcaaagctgaaaactatgcaaga
attatcttctagaaataaagcaagcctgctgggaaataaaagtaataagggaaagatgaa
ggaaaatcatcaaaaagaaaatcgaagtaaaaaataagcaaggagatcgatgatcaaaat
gaggagttagaggcaggtaattctataaagctactggagcaaccctctatgcttaaaaat
ggcaagctatagcctcatcaattagactctcttaactggatgattactctctatgatttg
gggttgaatggtatccttgctgatgacatgggtcttggaaagacaatttaagcaatcaca
atgctagtctatctgtaccagtataagaaaataaagggacctcatcttattatcactcct
aagtctactattagcaattggatgaaggaatttaatcattgggctccctttatgagagtt
gtaaacctcaaccctatgatggaattcagaaatgagatcatccaaaatcagatgcagaaa
gaccaattcgatgtatgtgttacaacatatgaagctgtgaatatctgtaattctgatctc
agaaaaattaactggcactactagatatacgatgaggctcacaaactcaaaaacagtgaa
ggtgttgtcagtataaattctagaaaactcagttgcagaaatagactgcttatgacagga
acgcctcttcaaaataacatccaagaattatggagtttgctgaattatctgatgccagaa
attttctcctcttctgacgatttctgtgattggttcaacctagactcacaaaaaaagacc
gaggctaagatggacttggaatcaatctagaaacttcacaaaatcatgaggccattcttg
ctcagaaggactaagaaggacttagaaactcaattaccagataagattgaaatgaatgtc
aaaataccattgacttcaatgcaacttgatctctatgaataacttctaaagactactact
atattcaattcaaagaacacctctacaaaaacatactacaatctcttgatgcaattaaga
aaagtttgcaatcatccttatttatttgaaaacgttgagcctgaaggtgctgaagaatat
ggagagcatattattgagaattctggaaagatgagattcttagataaattgcttaagaaa
gtttcacaataaaaagactaggcacttgttttttcattattcacaagtgttttggatatt
atagaagacttttgtatactcagaggctataagtattgcagacttgatggctcaactgat
ttagatacaagagaaacattgataaaggaatttgttgagcctggctctgatgttgtagta
ttcctactttctacaaaggctggaggtcttgggttgaatctaatgactgctaatcatgta
gtgctttatgactcagattggaatccttaagttgatttataggccatggatagagctcat
cgtattggataaaagaaaaaagtttatgtttatagattgatctgctcatcaacttgtgag
gagaaaatcattgagagataggctatcaaacttaagctagactaagttatcatttaataa
ggtaaagcggcagctatctctaacaacctcaacaaagatgaatatgaaaagatactttta
catggagcagctatgatcttgcaacagaaatagtaagctcattagcaagaagaaatcgat
atagagctactcatttaagacggagaatagagagctttataaatgaaagaagatgctaca
tagtaagctgagaaaatgaaaaactgtttcgatttcagttataatgaaatcgactatttc
tctttctagaatcaagattatagaaatgagaaagttaagttttaataactctagatggaa
gaacaacaaaagaaaatgcaagctatgatggaagagaacaaagatgggccgactcttggt
agaacaagaagatttgttcatatgagagatatgacaatgattgacactactatagattac
acagagaagcaaaagaaaaataaagataaagactttacacaaaaagtcaaaaagtaaagt
attggaatgatgtcaaaagtgcatgacttttaattctatgataatatcgaggagcttaaa
gaatatatggaaattatcaagagcaaggttgataattatgaaaatgtcacaaatgaagag
cttgaagtcctgaaaaacatgttaaacacagggtttcatagttggacattgagagaatat
caaaaattcattaaagcaatcagaaagtatagcattaaagatgttcaagctattgcgtaa
atgattgaaacgaaaactgttgaagaagtacaagaatacatgaatgtatttatgctcaga
tttagagagttgaaagagaaggacattgttatctcctaactgcaaaagagtgaccttgac
caaaagatattggaaactatcagagacttcgacattaataaggactatgtactgtttatg
caagaaaacaattattttaacagaaatacataccttgcaatgattgagaatgcacataat
aaaatgatgattcaaaacaataagataaaacctcaagatctttagcttaagattgatcac
ttcttccactcttagactaagcaaatggtttaagaacagctaaagtatataactattgca
atcagagctgaagactgtttaagaggccatatggcatttggaaatgaaagaaagaagatg
agagatcttattgacaaatcaaaaaaatttagttaagggttccaagaagggatttctgcc
aaggagaaagatttaagaaaaaaagatgcacagtaggagataaaacaagaaagtagatag
ataaagagagtaggggcaatagacgataatcttaagtttggaagaagaaagagaactgca
gcacttttccaaacagcaagagatccatcctcataaaaaatggatactaattga