Identifiers and Description

Gene Model Identifier

Contig5731.g6127

Standard Name

ZNF61 (6-Zn finger containing)

Aliases

None

Description

6-Zn finger containing

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • positive regulation of macrophage proliferation (IEA) | GO:0120041

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5731.g6127(protein)
MLGIEEQYIIGFKPIDMENDPIKFEEKKKNQPKKQKKEVQESEDEDYDSEDEEGQLQIPK
DVVRQVEDLQEDLFYLVCYLRQKTEEEIEIEQKVGYFLYSIIIQKQRIELEIDDEKSHLK
IKPEKGASKYMLCPFIQCLKEFSETGNLKTHMRTHTGERPFVCTFEGCQKEFITKGHLKT
HELIHSGDRPYACEKCDKSYSRSGRLKIHMRTHTGEKPFICPFDKCDKTFTEKGNLKTHI
RIHSGEKPYLCSFQDCDKSFTTQGHLTDHMRRHSGERPFKCTKCDMAFMRSSTLKIHLRR
HNGEKPFQCEGIDEIFDDEDSEPNYLPLNSNENHKIQLNRRASSQLDLTFCQEISKGFKK
VTEKKLKNKLAKQQENFENTPKFQGNNESKKKRIIKNEDKAKIKSQKEIKVDSPIMKEAE
KIEFKLDKSFQQIHKNLVQQNFEKQQYQMQQQSELNQSQQSSEISQLGLQSQLKFINNNS
TSTSQQNFSINYQTQQPQNCISIGNIGQATFNIPIAINVFPQQLGMKSATSSKQPSFQNL
FASLQQNQQGYTASKFQPSNSSNNNNNNNNNNGVQSPQRAGSQHNLYSFQQSPQGKTQFQ
SDPNASNYSPDSNQKVIMKHHQQSQPVQPGFQITHPKQHLEKWKNFGSFSSITSLNELIM
NNKSFGLPTIGNTFQNQYNFSCDSRPMSKQGSAHNLYSMQIQNMNKNNMMGQNSDMKGFV
KFHDSGMNLGEASLNQQVMNAGNFGSTIADSEALRQLQKTHSLTNLFSSNQKQVPLFPSE
IDQNNRPK


>Contig5731.g6127(coding)
atgctcgggatagaagaacaatacatcataggttttaaacctatcgacatggaaaatgat
ccaattaaatttgaggaaaagaagaaaaatcaacccaaaaaataaaaaaaggaggtttaa
gaatctgaagatgaggactatgattctgaggacgaggaaggttaattgtaaattcccaaa
gatgtggtcagataggtagaagacttgcaagaggatttgttttacttggtttgctatctg
agatagaaaacagaagaagaaatagaaattgaataaaaagtaggatattttctttattca
ataattatctagaaacaaaggatagagttggagattgatgatgagaaaagtcatctgaag
atcaagcctgagaaaggggcctctaagtatatgctatgtccatttatataatgtctcaaa
gaattctcagagactggaaatcttaagactcacatgaggactcatactggagagagacca
tttgtatgcacctttgaaggatgttaaaaagaattcataactaagggacacttaaagacg
cacgaattgatccattcaggagataggccatacgcttgtgaaaaatgcgacaaaagttac
tcaaggtctggacgtttaaaaattcatatgagaacccatactggagaaaagccatttatc
tgtcctttcgataaatgcgataaaacctttactgagaaaggtaaccttaaaactcatatt
aggattcactcaggtgagaagccatatctttgctccttctaggattgtgacaagtcattc
actacttaaggccatcttacggatcacatgaggagacattctggcgagaggccattcaaa
tgcactaaatgtgatatggcttttatgagatccagcactctcaaaatccatttaaggcgc
cataatggggaaaagccatttcagtgtgaaggtattgatgaaatatttgacgatgaagac
tcagaaccaaactatcttccactaaattcaaacgaaaatcataaaatacaattaaatagg
agagcaagttcttagctagatttaacattttgtcaagaaatatccaaagggtttaaaaaa
gtcactgagaagaaactgaaaaataaactagctaagtaacaagaaaattttgaaaataca
cccaaattttaaggtaataatgagtccaagaaaaagagaattattaaaaatgaggataaa
gcaaagattaagtcccagaaagagattaaggtagatagtcctataatgaaagaagctgaa
aagattgagtttaagctagataagagtttctaataaattcataagaatcttgtctaataa
aattttgaaaaacagcaatatcaaatgtaataatagtctgagctgaattagtcttagtag
tcaagtgagattagctaactaggactttaatcttagctaaagtttattaataataatagt
acctcaactagccaataaaacttctcaatcaactattaaacatagtaaccataaaattgt
atttcaattggaaatattggacaggctacatttaatatacccatagctattaatgttttt
cctcaataactgggcatgaaatcagcaacatctagtaaatagccatcattttaaaatctt
tttgctagtctttagtaaaattaataaggctacactgcctctaaattctaaccaagcaat
tccagtaacaacaacaataataataacaataataatggagtttaatcaccacagagagct
ggtagctagcataacttgtatagcttttaatagagtccataaggcaaaacctaattttag
tcagatcctaatgcaagcaattattcgcctgattctaatcaaaaagttataatgaaacac
cattaatagagtcaacctgttcagcctggtttttaaatcacacatcctaagtaacacctt
gagaaatggaaaaactttggatcattctcaagtatcacaagcttaaatgaactaatcatg
aataataaaagttttggcttaccaacaattggcaacacattttaaaattaatataacttc
tcttgtgattctaggccgatgtctaagtaaggaagcgcacataatttgtattcaatgcaa
atttaaaacatgaacaagaataatatgatgggataaaactcagatatgaaaggatttgtt
aagttccacgacagtggaatgaatcttggagaagcatctctgaattaataagtaatgaat
gcaggtaacttcggatcaactatagctgattctgaagccttaagacagctttaaaaaact
cacagtttaactaatttattttcatcaaatcagaagcaagttccccttttcccttctgaa
atcgatcaaaacaatagaccaaagtga