Identifiers and Description

Gene Model Identifier

Contig6134.g6560

Standard Name

ZRB1 (SNF2 family N-terminal domain containing protein; DNA-dependent ATPase)

Aliases

None

Description

SNF2 family N-terminal domain containing protein; DNA-dependent ATPase

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • obsolete mitochondrial aspartate/glutamate transport (IEA) | GO:0006845

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6134.g6560(protein)
MIKNFKKRKPQDWVKFDGQTKCWVIKLEAYNDVYEMLYLLEESMGVKFNYFDDKKKNYNL
EMLPQSLKDSLFNFQKEGVNFGISRYGRFLLGDEMGVGKTVQALARFTWFDEILKWLPDV
SSDDICLISSGKEDIFNDAKIYIMSYEIASKNTESFVKRGIRMVIADEAHYLKAYKVNTL
LTKTHTEFEKQKFSTPMLARPAELFNLIKMVRPDIFQDFQQFATRYCNPKESQFGMDYSG
ASNIKELHQLLEADDRKRIEEAIKERNKKFAQYDNIQISGVSYDGSKQFYGHTDDPEEKQ
LQKVYQLSGKAKIKGIIEFMDYMIESKKLIFTEQYIDQVKFILFAHHQSVICELENHLEQ
RLKEASNQNSQILPPYFIKIDGSTPPEIRHEMVKDFQEKEYVRVALLSITASSQGITLTA
ASTVIFAEVHWTPALMMQAEDRVHRIGQESDCVNIYYLYGKETLDEIIYPMIDLKSVVVA
RTLDDQKTDFKIKSAKKRQQPDYELKESDNEESQTNNNQINQKQNGEFSGKQDQKQCKRK
IKQEDKQSAKTQQHTNSQNQKPNQNLSKQTKSSNQQSKHSQSKENGVDEQFNSKLQPAVQ
NSNQSKKNKNQNKVQIVQPFLGGIIEENEDNEDNSKNEVKSMILELDARDYDDSGMSNQE
RSRLKPSKSQQNLQKQQNYSQLMNPAAITDPKLSSNISQQNQQSQQAQKFKMPVKQSLKN
SLQASINKINSQDSLELESQSQLKPKEECIKSIIKTEQKHSKSENQNQATYLNSSNNNNN
NNNQSQISQLMSQKSTNEGFSQKDMSQEEIKIKNIKDNMDKLLKSTNRFGFKK


>Contig6134.g6560(coding)
atgatcaagaatttcaagaaacgaaaaccctaagactgggtgaaatttgacggatagact
aagtgttgggttattaagctagaagcttataatgatgtatacgagatgctttacctgcta
gaagaatctatgggagtgaaattcaactactttgatgataaaaagaaaaattacaatctt
gagatgctaccttaatcgctcaaagattctctgtttaacttttaaaaagagggtgtcaat
tttggcattagcagatacggaagatttttgcttggagatgagatgggtgttggtaaaaca
gtttaagctcttgcaagatttacttggtttgatgagatactcaaatggctaccagatgtt
tcttcagatgacatatgtctgatctcttctgggaaggaagatatatttaacgatgccaaa
atatatataatgtcatatgagatagcatcaaagaacactgagtcatttgtcaaaagaggc
attagaatggttatagctgatgaagctcactatttaaaagcatacaaggtaaatacacta
ttaactaaaactcatacagagtttgagaagcaaaaatttagtactcctatgcttgctaga
ccagctgagttgttcaacttgattaagatggtgagaccagatatattctaggatttttag
taatttgcaactcggtattgcaatccgaaagaatcctagtttggaatggactattctgga
gcctcgaatataaaggaattacattagcttctagaggctgatgataggaagaggattgaa
gaagcaattaaagagagaaataaaaagtttgcatagtatgataacattcaaataagtgga
gttagctacgatggaagtaaatagttctatggacatactgatgacccagaagagaagcaa
cttcaaaaagtttattagctctcaggcaaagcaaaaattaagggaataattgaatttatg
gactatatgattgaaagtaagaaattgatattcacagagtaatatatagactaggttaag
ttcatcttgttcgctcatcattaatccgttatatgtgaactggaaaatcatttggagtaa
agactcaaagaggcaagcaatcaaaattcctagatacttcctccatattttataaaaata
gacggaagtactccacctgagattagacatgagatggttaaggatttttaggagaaggag
tatgtgagagtagcattactctctatcacagcatcttctcaagggataactttaacagca
gcttctacggttatctttgctgaagttcattggacacctgcgcttatgatgcaagctgag
gatagagtccatcgtataggccaagaaagtgactgtgttaatatctattacctttatggc
aaggaaactctagacgagattatatatcctatgattgatctcaaatcagttgtagtggca
agaactctagatgattagaagactgattttaagattaaatctgcaaaaaaaaggcaatag
cctgactatgaacttaaagaaagcgacaatgaagagtcataaacaaataataattaaatc
aactaaaaatagaatggagaattttctggaaaataagactagaagtaatgcaaaagaaag
atcaaacaagaagataaataaagtgcaaaaactcaatagcatactaactctcagaattag
aaaccaaaccagaatttatcaaaataaaccaaatctagtaatcaataaagcaagcattct
cagagcaaagagaatggtgttgatgaatagtttaacagcaagcttcaaccagcagtgtaa
aattcaaattaaagtaaaaagaacaagaactaaaataaggtctagatagtttagccattt
cttggtggtatcatagaggaaaatgaggacaatgaagataacagtaaaaatgaagttaaa
agcatgatattagagctagatgccagagactatgatgactctgggatgtcaaaccaagaa
agaagtaggcttaagccttccaagtcctaataaaatctctaaaagcaataaaattattcc
taactaatgaatccagcagcaataacagatcctaagttatcttcaaatatatctcagtaa
aactaataatcttaataggcttagaaatttaagatgcctgtcaaataatctcttaaaaat
tctttgtaggcaagtataaataagataaacagttaggattcactcgagttagaaagttag
tcttaacttaagcctaaggaagagtgcattaaatctattatcaaaactgaataaaagcac
tctaaaagtgaaaattaaaatcaagctacttatttaaacagcagtaataataataacaac
aataataatcaaagctaaatatcataattgatgtcatagaaaagcaccaatgagggcttc
tcataaaaagatatgtcacaagaggagataaagattaaaaacatcaaagataatatggat
aaattgctaaaaagcacaaatagattcggttttaaaaagtga