Identifiers and Description

Gene Model Identifier

Contig5113.g5472

Standard Name

ZRB3 (putative ZRANB3 homolog, ATP-dependent endonuclease)

Aliases

None

Description

putative ZRANB3 homolog, ATP-dependent endonuclease

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
12ZRB3Weston R, Peeters H, Ahel D. ZRANB3 is a structure-specific ATP-dependent endonuclease involved in replication stress response. Genes Dev. 2012 Jul 15;26(14):1558-72. doi: 10.1101/gad.193516.112. Epub 2012 Jul 3. PubMed PMID: 22759634; PubMed Central PMCID: PMC3404384.

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5113.g5472(protein)
MSDCEINFMDNDSGNDSDNNHGKKRNIFMKKRVIKKKAGADNKKKQQKLKKVFTFSHSKP
NGGSNIEDDDDNNQDIKEHANPEESNPFSSFSFDGGKNNGIMEQSQQSEYMNDNDLDSQY
PELGKEITQDDDSAISKKQNRLDWFKKNRMYLKRLRNQKADASSASQISDGIFDPDGVNK
DDLIVESFNAPSQKNKGQQAKEIEFSQAQEIYSMPETITFTNTVTYGRIVGKPSNENQDK
DAPPMVKYVKGYGRLSFYQNILLLAAFINFSQTKLKVQLVSLYSFQRDGIKKGIKFYGRI
VINDDFGTGKSLQALGLSLAYKNEWPLMILCPKFALYMWRYEILKWLPGYDINKIQIIKN
ESQAFDQQYSITIISYDHAAIMANKIEDYKFKVCIADEAQIFRARESKNGKILINLISNM
KRSIVLTGCNLTKKPQEIYSLMRIVRPDIMPGFYEFGYRYCDPRQSFEGIDFTNAGNMIE
LKQLLDKRIQTIYKRKYIFSELPDRMRQKLEITAETQIVVKIQSLLQNYVKPWEDQHPNQ
SFFLEMFQNFYENPNKDQTKFLCDPTDDSRPSFQKTLKQIFRDLYDYSGLAKLKVTQDII
DNILENGMRVLIFSYHLTFITSIEDHLSRKTKFLFLGKNVDDDYKQDICDKFNNEDEYKA
VLIDLSEDLSDIKFNTPNTIILFAETFWNTLYIERAEKMIDTPGQKSANNIIYLYGRYTL
DEYIYKLLYNQNQSLYSELEPLQLDLQNFRVQQTLGQNYDEIKDTQVNWNTQAFATYTQL
TQNQQNTDFQAIDPLAPVQIYQKGNLTLENMFLRQHLDNRQQEYLKEQKHVTNKDKQISQ
ESQDKDSDRIEGSQSDINDEDLVGVMTQKAGNKIKSKQKEEVKEEIKIEEQKCELDDLDD
DELNEILGL


>Contig5113.g5472(coding)
atgtcagactgcgagatcaattttatggataatgactctgggaatgactcagataataac
catggcaaaaaacgtaatatatttatgaagaaaagagtcattaagaaaaaagcaggtgca
gataataagaaaaagtaataaaaactgaaaaaagtattcacattcagtcattctaagcca
aatgggggcagtaacattgaagacgatgatgacaataaccaagacataaaagagcatgcc
aatcctgaggagagtaatccatttagcagtttttctttcgatggaggaaagaacaatgga
attatggaacaaagttagcaaagtgaatacatgaatgataatgatcttgattcttagtac
cctgaactaggtaaagaaatcacctaagatgatgactcagctatcagtaaaaagtaaaac
aggttagactggttcaaaaagaatagaatgtatttgaaaagacttcgaaatcaaaaagca
gatgcctcttccgcatcatagatcagtgatggaatatttgatcctgatggagtcaacaag
gatgatttaattgttgagtcattcaatgccccttcttagaaaaacaaaggatagcaagca
aaggagattgaattctcacaggcataagaaatatactccatgccagaaactataacattt
actaatactgttacgtatggtagaatcgtgggaaaaccttcaaatgaaaattaggataag
gatgcccctccaatggttaaatatgtcaaaggctatggtcgcttgagcttctatcagaac
atacttttgcttgcagctttcataaatttttctcaaacgaaattaaaagtttaattagta
tcgctatactctttccaaagagatggaatcaagaaggggatcaagttctatgggaggatt
gtaattaatgatgattttggaacaggtaaatctttataagcacttggcttatcactagcc
tataaaaatgaatggccactcatgatattgtgtcctaaatttgctctatacatgtggaga
tatgaaattttgaagtggttacctggctatgacataaataaaatatagataattaagaat
gaatcctaagcttttgattagtagtattctataactataataagttacgatcacgctgca
attatggcaaataaaattgaagattataaatttaaagtctgcatcgccgacgaagcatag
atttttagagcaagagagtctaaaaatggcaaaattttgattaatttaatcagtaatatg
aaaagatctattgttttaacaggatgtaacttaacaaaaaagcctcaagagatttacagt
ctcatgcgtatagtaagacctgatataatgcctggcttttatgagtttggatatagatat
tgtgatccaagataatccttcgaaggaattgatttcaccaatgccggtaacatgattgag
cttaagtaattgctagataagagaattcagactatttataagcgaaagtacatcttcagt
gaactcccagacagaatgagataaaaactcgaaattacagctgaaactcaaatagtagtg
aaaattcaatcactgctataaaactatgtgaagccttgggaggattaacaccctaattaa
agtttcttcttagagatgttccaaaatttttacgaaaatcctaataaagattaaactaaa
tttttatgtgatccaactgatgatagtagacctagctttcaaaagacgttaaagtagatt
tttagagatttatatgattactcaggtcttgcaaagttaaaagttacacaagatataatt
gataatattcttgaaaatggaatgagagttttgatattcagctatcatctaacctttatt
acttctattgaggatcatttatctagaaagactaagtttttatttctaggtaaaaatgtg
gatgatgattataagcaagatatatgtgataaatttaacaatgaagatgagtataaagct
gttttgatagacttgagtgaagatctatcagatattaaattcaatacgcctaatactatc
attctgtttgctgagacgttttggaataccctgtatattgaaagagctgagaagatgata
gatacacctggctagaaatcagctaataacataatttatctctacggtagatacacttta
gatgaatacatctataaactattatacaattaaaactagagtttatactcagaacttgag
cctctctaacttgatttgcaaaactttagagttcaataaacgcttggataaaattatgat
gaaataaaggacacataagtcaattggaatacccaagcctttgccacatatacttaacta
acttaaaactagcaaaatacagattttcaagcaatcgatcctcttgcgccagtttagatc
tatcaaaagggaaatttaactcttgaaaacatgtttttaaggtagcatcttgacaatcga
caacaggaatatctaaaggaataaaaacatgttacgaataaagataaatagatcagctag
gaatcataagataaagatagcgatagaattgaaggttcttaatcagatattaatgacgaa
gatctggttggggttatgacttaaaaagctggcaataaaattaaaagtaagtaaaaagag
gaagtaaaagaggaaattaaaatagaggagtaaaagtgtgaattagatgatctagatgat
gacgaattgaatgaaatcctaggtctttga