Identifiers and Description

Gene Model Identifier

Contig7394.g7902

Standard Name

HISA4 (histone variant H2A.4)

Aliases

None

Description

histone variant H2A.4

Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7394.g7902(coding)
atgggctcaatatagccctatatcgaatcttcttaacttaagcatactgagaaaattaaa
gcataccaaaaggcaagataagagtctaggaatatcaactaatcttaaaattgtacgatt
ataaatttcttaactttgaaaaattagtttaagaatcattatcattactagcaagccata
gatcgtcatttggtgttccagaccagatcaagaacaacgagtgattaaaaattacctgaa
ttacaaaaaaagaaaaaaagaggattgagtctatcaaaaagtatagcaaatttaaacaag
aatcaaaattaaagtttctagccttactaagatgagattaaggtttaggaaaaagataat
attgtgaggatcgatatattcaagaaattagcctaaggcttgaaagaaaaaatcaatggt
cattaagatgaatttgatgaattataaaataccttaagagactcataaaaaagagaatta
tacaataatgagaattaaattcataaaaacaaaaacatatcagttttaactcatagataa
aatctagaacttatttcatagcttagctaggcagataagtttctctctaaattatcctaa
aaatattagactaaagaaaaagattgcaaaactttgatccaataatctaaagatgaaatt
tctgaagtacatcaaggattaaaaaagatagtggctgcatcaaattttcacacttaaatt
tactcaaacaggtattagacagtagatatcccatctgaatctcctgtttttattctgatg
atacctgctgaataaagatcaccagctgttttcaaaattgatcctatagttgactaaaag
caaagaaagctaatggactataagatcttttttagtacaaagattaaataccctaatgaa
gataattgcgacaaaatatatcataatgaataaaaaattatatataagcgtggctaatta
ggtgaagagtttccgcatactttcaaaatatatttgggtatatggtctaagatctaaatg
taattggctattacagtttcttttccttttaaccccgaaacgaatagcaaaggtatcaaa
gtctcatcaccattgaaagtaaaaagaactattattgacgaagaaggaaatgaaatggaa
attgaagtaatccgagatatagattatgagaatagactgaagaaatctaactatattgca
attgctcaagaaaaaaaggtttagaaagaaaaagaacatcgctaaaaaagctttttccta
ttaaataaaagagagattttaaatgcttagatttagatgtgctaagattatcggaaaaag
ttataaaaaccatctaaaaaagagaggaataaattttcaaatgagaattcactagatgtc
taaaatgtaaatatcatattttcctacttctgggtagcttttaacaataattttaggatt
ctgactttcttacttaatactgatcatgtttaaagataaaataaagctaataatattcta
aaatacgtacttgagagaacttcagcgatggattaattcaagcagaaaatgcaaaggttc
cacaaaagaggatactgggaataagaggtgctattactcacaggctcactcctttcataa
agaaagttatctaaaaagttaaaacctctaataaaaaagctaaacttgatttctgaaaat
ttaattgataaaactgtcaaacagtacttttaatactgcaaatttaaattcataataaaa
tttcttgattggagaatcaagaagctgcgattctaaaataagcctataaatgaggagtgg
tttgaggaaatttaaaatttgaggataatggtaggataaagagaaaaaattttgtttgaa
gatattggctaaattgctgaattagccctctagaaaatactttaaagatcaggagtacaa
agtcctaaataaggatcccctaactctcctagaagaaagaagagtccaagtcccattaat
gataattctaaataaatgtagcaacttggtagtctttagattaataaataatttccacct
tatgataacaaattaaatccgaatgctcatggtttgatcagattaaggacactaaataat
gattaaattataatggatgaatatttgtagcaagatatagtagatcctggccccccacca
atttttatgtttatgcctagcaaagatcaaattagaaaaatgattctgaaaactacaaga
tatgataataaagacatataactgatgaaacttgattaaaaaagaatatatggactaaaa
ggcaagggtaaaggtatgggaggtaaaaattctgggaaatttacaaaaagaggtccaata
tcaaaatctttgaaggcaggtctatagtttcctgttggaagattgcacagacagctaaaa
cttagaacataattgaatgcaagagtaggagctactgcagcagtttattcagctgcaatt
ttggagtatctgactgcagaagttttggaacttgctggaaatgcttcaaatgatctaaaa
gcaaaaagaattacaccaaggcatttgactttagcaataagaggagatgaggaacttgat
actttaatcaaggctactattgcaggtgggggagttatccctcatattcataaaagactt
ctgacaaatattaaaaaatcaaataaaaagtga


>Contig7394.g7902(protein)
MGSIQPYIESSQLKHTEKIKAYQKARQESRNINQSQNCTIINFLTLKNQFKNHYHYQQAI
DRHLVFQTRSRTTSDQKLPELQKKKKRGLSLSKSIANLNKNQNQSFQPYQDEIKVQEKDN
IVRIDIFKKLAQGLKEKINGHQDEFDELQNTLRDSQKRELYNNENQIHKNKNISVLTHRQ
NLELISQLSQADKFLSKLSQKYQTKEKDCKTLIQQSKDEISEVHQGLKKIVAASNFHTQI
YSNRYQTVDIPSESPVFILMIPAEQRSPAVFKIDPIVDQKQRKLMDYKIFFSTKIKYPNE
DNCDKIYHNEQKIIYKRGQLGEEFPHTFKIYLGIWSKIQMQLAITVSFPFNPETNSKGIK
VSSPLKVKRTIIDEEGNEMEIEVIRDIDYENRLKKSNYIAIAQEKKVQKEKEHRQKSFFL
LNKREILNAQIQMCQDYRKKLQKPSKKERNKFSNENSLDVQNVNIIFSYFWVAFNNNFRI
LTFLLNTDHVQRQNKANNILKYVLERTSAMDQFKQKMQRFHKRGYWEQEVLLLTGSLLSQ
RKLSKKLKPLIKKLNLISENLIDKTVKQYFQYCKFKFIIKFLDWRIKKLRFQNKPINEEW
FEEIQNLRIMVGQREKILFEDIGQIAELALQKILQRSGVQSPKQGSPNSPRRKKSPSPIN
DNSKQMQQLGSLQINKQFPPYDNKLNPNAHGLIRLRTLNNDQIIMDEYLQQDIVDPGPPP
IFMFMPSKDQIRKMILKTTRYDNKDIQLMKLDQKRIYGLKGKGKGMGGKNSGKFTKRGPI
SKSLKAGLQFPVGRLHRQLKLRTQLNARVGATAAVYSAAILEYLTAEVLELAGNASNDLK
AKRITPRHLTLAIRGDEELDTLIKATIAGGGVIPHIHKRLLTNIKKSNKK