Identifiers and Description

Gene Model Identifier

Contig778.g848

Standard Name

PIWI11 (Piwi-like 11)

Aliases

None

Description

Piwi-like 11

Genome Browser

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig778.g848(coding)
atggattatagaagtagagaccgtggaggtcaccaaggaagaggagaagcatttggaaga
ggtgacaatagaggccacagaggtagagctgaagggccgaatagaggaggctcaggattt
tcatcagcaccttaaatattctagggataagtaggacagcttacaactctgcaatcaaat
catcacagaatgagcactataaaagaacatggagtgtttcatgtctacaggctaaatttt
gctccagaacctaggtttagctcagaaaaatcgtcaataataaaaaactcaaaataagct
cttgaaactatttatggttagatctactcttacggaaacgaccttttctcaatttttgag
gttagagaggaacagattataaactcttaattcaaaggatctcaatttgaggtgatcata
aattacgaaacatcattctccctcagttcctaagataaagagcattaaaaatacaaaggg
aaaattttgaactttatataagtagcaataaagaaaacgctgtatgaattctagttcaaa
caagtaggaaggcttcctaggttttatctgcatacagatctttaggatgtagcaaactat
aatttgcgtgtttggtcaggctattctatggcagtttagagttttaatgatggaatattc
gtgaacattgattgtgctacaaaatttgttgaaaaaagttctgtcctagatttaattaga
agactgtaaaaagacaaatactctcaagcagatatcaagcaagagcttgttcctaaagat
tagaatgagaaaggactagtagtcattaccatgtacaactccaagaaatatcaaattgat
gatattcgctttgacattactcctaaaaaccacatctttgagtatgaaatctatgatcct
gaaacaaagcaaagatataagcataagtctaacatggtcgagtatatgaataaaaaaaat
ggaataatcattcctgtataagattaagatcagccaactctgcaatcaaactatagggat
attaccatttatctaattccttcattgtgcttcaaagatggactagacaaaaattttact
agtgactcaaggaaaatgagggatcttcaagaatacaaacttagtcatcctgaatagaga
tacgaaaggattaactaattgattgaaaaattttaagcagcttaaattcttgagaactgg
ggattaaagatagatgccaattttactaatgtcaaggctaagcagcttccgccacctaaa
atcatcgacaatcgtaataatgaacagaattggtcagattacgaataaagaaaggtaaag
cctttagaataacttaaacttaagaaagaaacttgggccttaatctatgggtcattagat
tttgacaatgccaataatgcgatgtagatgtttaaacaagttggatcttaacatagtttt
atcgtggaggagccatagtacattgaacttcctagaaatgataatggtgatttgtttgta
aatggcataatatcagatatagatcctaaatacatatctattgctgttgtgatatttgga
aaaagacaaggccctgaaaaagctaaaataaaagctcaactagatctaatgggaatccct
tcataatttatgtgctcacaaactatttagtcaaaaggaaaaaatgcatcaatttttgca
gatactcttaagcaaatgagtgctaaaatgggattagatttgtataacttatccttacca
tgctacaaaaagactatggttattggaactgatgtagtaatttcaaaaggcaacactatc
atgggaatgacagcttcatataacttacaattatcaaaatattactcaagagttgataca
cataaaatgcctagtagagaatctggttaagattaaagatcataggatgaaaaacaataa
ctgatcactgagagtaggtgttaaattctctgcaaattcattaaagattctttacaaaat
tatcaacagtgttagaatggtccatatcctgaattaattgtgatttaccgagatggtatt
ggaggtgaatcaatgtaagataaatgctaagaatttgaaataactagagtgatagaggta
attcaatcatcatttgaaggatataaccctgcgatagtctattgttttgtaaacagaaat
aactagcatagactattcgctaagtataatggttagattatgaacccttcatcaggaaca
gtgttagatatagggcttgttgaaaatcaaggagaaaatacttttgatctataaatgata
gctcctaagactacagttgctactgcttaaccagtatagttaagagttgtgtataacaca
tctaacctgacaaaagactaattcgaacttagcacttaccatttgtgctttaactatgtg
aactattgtggtccaattaaggtaccttctgtttgtatgtatgccaagaaaatagcgcaa
tatgctgctgacaaccaaataaggcctaatgataagttaggtcatctactacactttatt
tga


>Contig778.g848(protein)
MDYRSRDRGGHQGRGEAFGRGDNRGHRGRAEGPNRGGSGFSSAPQIFQGQVGQLTTLQSN
HHRMSTIKEHGVFHVYRLNFAPEPRFSSEKSSIIKNSKQALETIYGQIYSYGNDLFSIFE
VREEQIINSQFKGSQFEVIINYETSFSLSSQDKEHQKYKGKILNFIQVAIKKTLYEFQFK
QVGRLPRFYLHTDLQDVANYNLRVWSGYSMAVQSFNDGIFVNIDCATKFVEKSSVLDLIR
RLQKDKYSQADIKQELVPKDQNEKGLVVITMYNSKKYQIDDIRFDITPKNHIFEYEIYDP
ETKQRYKHKSNMVEYMNKKNGIIIPVQDQDQPTLQSNYRDITIYLIPSLCFKDGLDKNFT
SDSRKMRDLQEYKLSHPEQRYERINQLIEKFQAAQILENWGLKIDANFTNVKAKQLPPPK
IIDNRNNEQNWSDYEQRKVKPLEQLKLKKETWALIYGSLDFDNANNAMQMFKQVGSQHSF
IVEEPQYIELPRNDNGDLFVNGIISDIDPKYISIAVVIFGKRQGPEKAKIKAQLDLMGIP
SQFMCSQTIQSKGKNASIFADTLKQMSAKMGLDLYNLSLPCYKKTMVIGTDVVISKGNTI
MGMTASYNLQLSKYYSRVDTHKMPSRESGQDQRSQDEKQQLITESRCQILCKFIKDSLQN
YQQCQNGPYPELIVIYRDGIGGESMQDKCQEFEITRVIEVIQSSFEGYNPAIVYCFVNRN
NQHRLFAKYNGQIMNPSSGTVLDIGLVENQGENTFDLQMIAPKTTVATAQPVQLRVVYNT
SNLTKDQFELSTYHLCFNYVNYCGPIKVPSVCMYAKKIAQYAADNQIRPNDKLGHLLHFI